SecReT4
Protein ID: 29171601
T4SS name [ID]Tra_I [177]
Gene symboltraO-1
Locus tagPSPTO_B0061
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000B [GenBank: NC_004632] [Browse all T4SS(s) in this replicon]
Location [Strand]49799..51157 [+]
ProducttraO protein
Component typeTraO_I
UniProt IDQ877K9
KEGG IDpst:PSPTOA0053, pst:PSPTO_B0061
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 452 a.a.     [Download]
>gi|29171601|ref|NP_808647.1| traO protein [Pseudomonas syringae pv. tomato str. DC3000]
MANENDAKRDMKLTAALVGGALVVVFGGAYYLWDWLARPEPAQSKVDLGRVAQASRSHSTESPAYRDLLK
QYNEEGASTAKNENSSFIASMPMEQTSVMLPVTKAKPAPQAEPTARRSHTRQDENSKDSEKKEDPRLKAL
LERINPEKKAEERQSGLVFAHVLGGTNALNGSGDTNTGSAGGYDSWSETLPGGAKLKTASMKSTAEPYSP
VEVVPPYWRGAGVIDIGVDSDNSTTPVLGKLSGPYAGAVLKAPEGARLAGDGVVIHFTEMAFNGVNYKVD
AYALQDDTLLANVASEVNHRYMSRIVLPAVLGGIGNISDMYSQANTQVLSNGFSTQTARPGMPDGTAVAG
TILGGAAGQAAKVLTEDAARTPATQVNVFKGQVVAIQFMRGVYAGDAVAPGRSGETVQPAAPAQAVMSAQ
PQSPAQPLTPDQWRAQTQTRIQAQRKLQESQQ
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|29171546|ref|NC_004632.1|:49799-51157 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence
ATGGCAAACGAAAACGATGCCAAACGCGACATGAAACTCACCGCAGCGCTGGTTGGAGGCGCATTGGTGG
TCGTTTTTGGCGGTGCCTATTACCTTTGGGACTGGCTGGCCAGGCCTGAGCCGGCGCAATCGAAGGTAGA
CCTGGGTCGAGTAGCACAAGCTTCGCGCAGCCACAGCACTGAAAGCCCTGCCTATCGCGATCTGCTCAAG
CAATACAACGAGGAAGGGGCCAGCACGGCTAAAAACGAAAACAGCAGCTTCATTGCCAGTATGCCCATGG
AGCAGACGAGCGTGATGCTGCCTGTGACGAAGGCCAAGCCTGCCCCTCAGGCAGAGCCTACCGCCCGGCG
TAGCCATACTCGTCAGGACGAGAACTCAAAAGACTCCGAAAAGAAGGAAGACCCGCGTCTGAAGGCATTG
CTAGAACGGATCAATCCTGAAAAAAAAGCCGAAGAGCGGCAGTCCGGACTGGTCTTCGCCCATGTTTTAG
GGGGAACTAACGCTTTGAATGGCTCAGGCGATACGAACACGGGTTCTGCTGGAGGCTATGACAGCTGGAG
TGAAACCCTGCCGGGAGGTGCCAAGCTGAAAACCGCTTCCATGAAAAGCACCGCAGAACCCTATTCACCT
GTCGAAGTGGTGCCGCCCTACTGGCGCGGGGCTGGCGTGATCGATATCGGTGTGGACTCGGACAACAGCA
CCACGCCGGTGCTGGGCAAGCTGTCCGGGCCTTATGCCGGGGCTGTGCTCAAGGCACCCGAGGGCGCCAG
GTTGGCCGGTGATGGTGTGGTGATCCACTTCACTGAAATGGCCTTCAATGGCGTCAATTACAAAGTCGAT
GCCTATGCGCTTCAGGACGACACCCTGTTGGCCAACGTGGCTTCTGAAGTGAACCACCGCTACATGTCAC
GCATTGTGTTGCCAGCGGTACTGGGCGGCATTGGCAATATCAGCGATATGTATTCGCAGGCCAATACTCA
GGTCCTCAGCAATGGCTTTTCCACCCAGACCGCCCGACCGGGCATGCCGGATGGTACCGCCGTCGCCGGC
ACCATTCTGGGCGGTGCCGCCGGTCAGGCGGCCAAAGTGCTGACTGAAGACGCCGCCCGCACCCCGGCTA
CCCAAGTCAATGTGTTCAAGGGGCAGGTGGTCGCGATTCAGTTCATGCGAGGCGTATACGCAGGTGATGC
CGTTGCCCCAGGGCGAAGCGGTGAAACGGTGCAACCTGCGGCTCCCGCTCAGGCCGTCATGTCGGCACAA
CCCCAGTCCCCAGCCCAACCGCTGACGCCTGATCAATGGCGTGCGCAGACCCAGACGCGAATCCAGGCGC
AGCGCAAGCTGCAGGAGAGTCAACAATGA
 Primer design