SecReT4
Protein ID: 29171602
T4SS name [ID]Tra_I [177]
Gene symboltraP-1
Locus tagPSPTO_B0062
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000B [GenBank: NC_004632] [Browse all T4SS(s) in this replicon]
Location [Strand]51154..51864 [+]
ProducttraP protein
Component typeTraP_I
UniProt IDQ88BS4
KEGG IDpst:PSPTO_B0062
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 236 a.a.     [Download]
>gi|29171602|ref|NP_808648.1| traP protein [Pseudomonas syringae pv. tomato str. DC3000]
MSEFSPAEPKASTIEMPAPTQAPSRSVWQRPIVMGLSLPWLIGIALVLALAGWYLFGPEKTASVNRLAFE
NDFEQQPLPAEQSSTPPVAAAAESDLGQFKNEVAAMIGGVRTYAEVNRTAIQRLSETIKTQGVAQQALQQ
QLAEAQAQNSVLSARLSFLEGRPGATTTTQQASKPVAKTRSPLNGMRVQAIQNGMAWVYWQDKTWAVSPG
EKLGQVTVTGINPQAREVLTSAGTIK
 
Nucleotide Sequence: 711 bp     [Download]
>gi|29171546|ref|NC_004632.1|:51154-51864 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence
ATGAGCGAGTTCAGTCCAGCAGAGCCCAAGGCATCGACGATTGAAATGCCGGCTCCCACCCAGGCTCCCA
GTCGTAGCGTGTGGCAACGCCCGATCGTCATGGGGCTTTCACTTCCCTGGCTGATCGGCATTGCCCTGGT
ATTGGCACTGGCTGGCTGGTACTTGTTTGGCCCCGAGAAAACCGCGTCAGTCAATCGTCTGGCCTTTGAA
AATGACTTCGAACAGCAACCTTTGCCCGCTGAACAGTCGAGTACCCCCCCTGTTGCAGCCGCTGCCGAGT
CTGATTTGGGCCAGTTCAAGAACGAGGTTGCGGCCATGATCGGCGGGGTGCGTACCTACGCAGAGGTGAA
TCGCACCGCGATCCAGCGCTTGTCCGAAACGATCAAGACTCAGGGGGTTGCACAACAGGCGTTGCAACAG
CAACTGGCCGAGGCACAAGCGCAAAACAGCGTCTTGTCAGCACGTCTGTCCTTCCTTGAAGGACGACCCG
GCGCGACGACCACGACACAGCAGGCCAGCAAGCCAGTCGCTAAAACACGTTCGCCGTTGAATGGTATGCG
CGTGCAAGCCATTCAGAACGGCATGGCCTGGGTGTACTGGCAGGACAAGACCTGGGCCGTCAGTCCCGGC
GAGAAACTGGGCCAGGTGACTGTCACCGGCATCAATCCCCAGGCCCGCGAAGTGCTGACCAGCGCGGGCA
CAATCAAATGA
 Primer design