SecReT4
Protein ID: 29171603
T4SS name [ID]Tra_I [177]
Gene symboltraQ-1
Locus tagPSPTO_B0063
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000B [GenBank: NC_004632] [Browse all T4SS(s) in this replicon]
Location [Strand]51873..52415 [+]
ProducttraQ protein
Component typeTraQ_I
UniProt IDQ877K4
KEGG IDpst:PSPTOA0055, pst:PSPTO_B0063
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 180 a.a.     [Download]
>gi|29171603|ref|NP_808649.1| traQ protein [Pseudomonas syringae pv. tomato str. DC3000]
MDGSTDAIQMLVNLSHNLLTSLVNFAFTLGSLFAVTGAVSYLATHASAARKAPGHAEGGGKVIAVLLLCG
GLAGLDQMIGAAARQLGWQGATFDAISYVDVGTFGVAADAANAVLSLVRMLGVWFALQGMLSWKRSFKDG
HTGLSASQDVSSGTLKFVLGVFCVCNPYLLSALQKTLGLL
 
Nucleotide Sequence: 543 bp     [Download]
>gi|29171546|ref|NC_004632.1|:51873-52415 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence
ATGGACGGCAGTACTGACGCGATTCAAATGTTGGTCAATCTGTCCCACAACCTGCTGACTTCCTTAGTCA
ACTTTGCCTTCACGCTGGGCAGCTTGTTTGCGGTCACTGGCGCTGTGAGCTACCTCGCCACTCACGCCAG
TGCCGCGCGCAAAGCACCTGGCCATGCGGAAGGTGGCGGCAAGGTCATCGCTGTGTTGTTGCTCTGTGGA
GGCCTGGCCGGCCTCGATCAAATGATCGGTGCTGCCGCTCGCCAGTTGGGTTGGCAGGGCGCGACCTTCG
ATGCCATCAGCTACGTGGACGTGGGCACCTTTGGTGTCGCAGCCGATGCGGCCAATGCCGTGTTAAGTCT
GGTGCGCATGCTGGGCGTCTGGTTCGCGCTGCAAGGCATGTTGTCCTGGAAACGCTCGTTCAAGGACGGT
CATACGGGCCTATCGGCCAGTCAGGACGTTTCAAGCGGTACCCTCAAGTTTGTCCTGGGCGTTTTCTGCG
TATGCAATCCGTACCTGCTTAGCGCCCTGCAAAAAACCCTCGGCCTGCTGTAA
 Primer design