SecReT4
Protein ID: 29171604
T4SS name [ID]Tra_I [177]
Gene symboltraR-1
Locus tagPSPTO_B0064
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000B [GenBank: NC_004632] [Browse all T4SS(s) in this replicon]
Location [Strand]52485..52886 [+]
ProducttraR protein
Component typeTraR_I
UniProt IDQ88BS3
KEGG IDpst:PSPTO_B0064
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 133 a.a.     [Download]
>gi|29171604|ref|NP_808650.1| traR protein [Pseudomonas syringae pv. tomato str. DC3000]
MAMSKDVMLCAAVRLSIFKDGLRQHILKGLAAAIAANPVLAFAGAGGADIAGMGNSAAVGAKSLQKNALT
IAQFVGVVFVITGLVAAKNKKDNPQIKTGHIVGSILFGVCLAVIPEIIKRSQAQVGLAPVDVG
 
Nucleotide Sequence: 402 bp     [Download]
>gi|29171546|ref|NC_004632.1|:52485-52886 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence
TTGGCTATGTCCAAAGACGTAATGCTGTGCGCTGCTGTTCGCCTGTCGATTTTCAAAGATGGTCTGCGTC
AACACATATTGAAAGGCCTGGCGGCAGCGATAGCTGCCAACCCAGTGCTGGCTTTTGCCGGTGCCGGCGG
TGCCGACATTGCCGGGATGGGTAATTCGGCGGCAGTGGGCGCCAAGTCGTTGCAAAAGAATGCGCTGACC
ATTGCTCAGTTTGTGGGGGTAGTGTTTGTGATCACTGGGTTGGTTGCTGCCAAGAACAAAAAGGACAACC
CTCAGATCAAAACTGGCCATATCGTGGGGTCCATCCTGTTTGGCGTGTGCCTGGCAGTGATCCCGGAAAT
CATCAAGCGCTCGCAAGCTCAAGTTGGCCTGGCACCCGTGGATGTGGGCTAA
 Primer design