SecReT4
Protein ID: 29171605
T4SS name [ID]Tra_I [177]
Gene symboltraU-1
Locus tagPSPTO_B0066
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000B [GenBank: NC_004632] [Browse all T4SS(s) in this replicon]
Location [Strand]53554..56610 [+]
ProducttraU protein
Component typeTraU_I
UniProt IDQ88BS2
KEGG IDpst:PSPTO_B0066
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.7e-53, Aligned region: 498..892
Protein Sequence: 1018 a.a.     [Download]
>gi|29171605|ref|NP_808651.1| traU protein [Pseudomonas syringae pv. tomato str. DC3000]
MPSLIRWVEDLITETSRFAVSRDLPDYCDLNTVLRLTDDDRTRHPALNAPYVLVNDDGDYCSVYAVAGSF
CDTDEAAPLEAPYSWAGRLERMMHALTAHYRRHGHKISLVFDDDPDRGREDVERLLAPQYASVKRTGIDL
TPILDENVEKLAPWVSRERCYLVCYTGRKTLSAHELIDENRRIKQLIGQSPDARYGQNPVLAEMAGLKIR
HDAFMSAVEAAFKDDGQGVLLELLDAHAVGQALRSQVDRLGTSEHWYPLLPDDPITPHGVRNGDDHTPFL
APQLKFQLMNQDMETNGNKLCVNGMWHGTLSVVLGPQTPQTFAKLKALVPRGVPWRVRMDLMPGGMKSLG
MKKGTLDFMAFVPPLRPIWNSIETLTKVEQQEPVCVMTIMASTWGDSQAAVTRHLTLLTQAFQAWGVCEV
TQTFGNPVRAWASTLVASSKGSGPNLLYPPLSEALNLLPLTRPASAWEEDGNALFATLDGKLYPVGLATP
KQNKLTSVVTGSSGQGKSVLLNKLGNVTVSSAQQRLPFMAGVDKGFSMQGQVALLRDSLPPERKDEVVGI
VLQNSPKHCRNLFDIQLGARFPIAPERNWIISMLTAMCIDPSTGNPPNERDTRQILDRVISMAYTANAEK
SPRRWGRGVVPEVDTALDKSGLIERYPAQWWDSSTWYEVRDLLFEAGFVKEAQLAQFEAVPELADMTTFL
NHEDVQSAYGRVQRDGSQELLLEYLHRCMTDACREFKMLAGRTQFLISPRTRVIAIDLNNVMGDNTTNAG
HLKTGIMFLFAGQVAGGDFVLPQYRDELLEAVPTLYHPMHLDRLEQLDQEVKTKIYDELHNAKQVPFIFP
MLETQDREQRKFGIRTVLSSQYVSDFPDAILNSANSLYMMEVDPKDEKLLTDTIKVPKVTLQRFQRLGSG
PAADGSGVPFLGVFRIKGGGTLARILKNAMGPLELWALGSSPTDSALRRLLYDAVGGATARAILAEAFPQ
GTAEKLIALRQKQAGEADSNNVIGTLANELIKRRGYNI
 
Nucleotide Sequence: 3057 bp     [Download]
>gi|29171546|ref|NC_004632.1|:53554-56610 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence
ATGCCGAGCTTGATCCGTTGGGTTGAAGACCTGATCACAGAAACCTCCCGGTTTGCCGTATCACGCGATC
TGCCCGACTATTGCGACTTGAACACGGTACTGCGTCTGACGGACGACGATCGCACTCGCCACCCAGCCCT
CAATGCCCCGTATGTACTGGTCAACGACGATGGCGATTACTGCTCGGTGTATGCCGTTGCCGGCAGTTTT
TGTGACACCGACGAAGCGGCACCCCTGGAGGCCCCTTATTCCTGGGCCGGCCGCTTGGAGCGCATGATGC
ATGCGCTGACAGCCCACTATCGCCGACATGGACACAAAATCAGCCTGGTGTTCGATGATGACCCTGATCG
AGGCCGCGAGGACGTCGAACGCCTGCTGGCCCCTCAGTACGCTTCTGTCAAAAGGACCGGCATCGACTTG
ACGCCGATCCTGGACGAAAACGTTGAAAAGCTGGCCCCCTGGGTTTCGCGCGAACGCTGCTACCTGGTGT
GTTACACCGGGCGCAAGACGCTCTCGGCGCATGAACTGATTGACGAAAATCGCCGTATCAAGCAATTGAT
CGGGCAAAGCCCGGATGCACGGTATGGACAAAATCCGGTCCTGGCTGAAATGGCCGGCCTGAAAATTCGC
CACGACGCCTTCATGAGCGCTGTGGAAGCTGCCTTTAAAGATGACGGCCAGGGTGTGCTGCTGGAACTGC
TCGATGCCCATGCAGTGGGCCAGGCGCTGCGCTCTCAAGTGGACCGGCTCGGTACCAGTGAGCATTGGTA
CCCGCTGCTCCCTGATGATCCGATCACCCCGCACGGTGTACGTAACGGCGACGATCACACACCGTTTCTG
GCCCCGCAGCTGAAGTTTCAGCTGATGAACCAGGACATGGAAACCAACGGCAACAAGCTCTGCGTCAATG
GGATGTGGCATGGGACCTTGTCTGTAGTCCTGGGGCCGCAGACGCCGCAGACCTTTGCCAAGCTCAAAGC
GCTGGTCCCTCGCGGCGTGCCTTGGCGCGTACGCATGGACCTGATGCCTGGAGGCATGAAGTCGCTGGGC
ATGAAAAAAGGCACGTTGGACTTCATGGCGTTTGTGCCGCCGCTTCGCCCCATCTGGAACTCCATCGAAA
CGTTGACGAAAGTCGAGCAGCAGGAGCCGGTGTGTGTCATGACGATCATGGCATCGACCTGGGGAGACAG
CCAGGCCGCAGTGACGCGCCATCTGACGCTGCTGACCCAGGCCTTTCAGGCCTGGGGGGTGTGCGAGGTG
ACGCAAACCTTCGGCAACCCGGTACGCGCATGGGCCTCGACGCTGGTGGCTTCCAGCAAAGGCAGTGGCC
CGAACCTGTTGTATCCGCCGCTTTCAGAGGCGCTGAACCTGTTGCCGCTGACCCGCCCTGCCTCGGCTTG
GGAGGAGGACGGCAACGCCTTGTTCGCTACGCTCGATGGCAAGCTCTATCCGGTCGGTCTGGCCACCCCC
AAGCAGAACAAGCTCACCAGTGTGGTCACCGGCTCTTCCGGCCAGGGCAAGTCGGTGCTGCTGAACAAGC
TGGGCAATGTCACGGTGTCCAGCGCCCAGCAGCGATTACCGTTCATGGCGGGGGTGGACAAAGGTTTCTC
GATGCAAGGTCAAGTCGCCTTGCTGCGCGACAGTCTGCCGCCGGAGCGTAAGGACGAGGTGGTGGGCATT
GTGCTGCAGAACAGCCCCAAGCATTGCCGGAACCTGTTCGATATCCAGCTGGGCGCGCGGTTTCCGATCG
CCCCCGAGCGTAACTGGATCATCAGCATGCTCACGGCCATGTGCATTGATCCCTCTACCGGCAATCCGCC
AAACGAACGCGATACCCGGCAAATACTGGACCGCGTCATCAGCATGGCCTATACCGCCAATGCCGAAAAA
AGCCCCAGACGCTGGGGGCGCGGGGTCGTCCCCGAAGTGGACACTGCCTTGGATAAAAGCGGGTTGATCG
AGCGCTATCCGGCCCAGTGGTGGGATAGCAGTACCTGGTATGAGGTGCGCGATCTGTTGTTTGAAGCAGG
CTTTGTTAAGGAAGCGCAGCTGGCCCAGTTCGAAGCGGTGCCGGAACTGGCCGACATGACCACCTTCCTG
AACCATGAAGATGTACAGAGCGCCTATGGTCGGGTGCAACGCGATGGCAGTCAGGAGCTGTTGCTGGAGT
ACTTGCACCGATGCATGACTGACGCCTGTAGAGAATTCAAGATGCTGGCCGGGCGTACGCAGTTCTTGAT
CAGTCCACGCACGCGAGTGATCGCGATCGATCTGAACAATGTCATGGGTGATAACACCACCAATGCTGGC
CACCTGAAAACCGGAATCATGTTCCTGTTTGCGGGCCAGGTGGCGGGGGGAGATTTTGTGTTGCCGCAAT
ACCGGGATGAGCTGTTGGAGGCGGTGCCCACGCTTTACCACCCCATGCATCTCGACCGCTTGGAGCAGCT
GGATCAGGAGGTCAAAACCAAGATCTACGACGAGCTGCACAATGCGAAACAGGTGCCCTTCATCTTTCCC
ATGCTGGAAACCCAGGACCGTGAGCAACGCAAATTCGGCATACGCACGGTGTTGTCCTCGCAGTACGTGA
GCGACTTTCCCGACGCCATTCTGAATTCGGCCAACTCGCTGTACATGATGGAAGTGGACCCCAAAGACGA
GAAGCTTCTGACCGACACCATCAAAGTGCCCAAGGTCACTCTGCAGCGCTTTCAGCGTTTGGGCTCAGGT
CCAGCAGCGGATGGCAGCGGCGTACCGTTTTTGGGCGTGTTCCGAATCAAGGGTGGCGGCACCCTGGCGC
GCATTCTGAAAAACGCCATGGGCCCCCTGGAGCTATGGGCGTTGGGCTCTTCACCGACCGACAGCGCCCT
GCGCAGGTTGCTATATGACGCCGTCGGCGGTGCCACGGCTCGCGCCATCCTGGCCGAAGCCTTTCCCCAG
GGCACGGCAGAAAAACTCATCGCGCTGCGCCAGAAGCAAGCGGGTGAAGCGGATTCCAATAACGTGATTG
GCACGCTGGCCAACGAGTTGATCAAACGGCGCGGCTACAACATTTGA
 Primer design