SecReT4
Protein ID: 29171606
T4SS name [ID]Tra_I [177]
Gene symboltraW-1
Locus tagPSPTO_B0067
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000B [GenBank: NC_004632] [Browse all T4SS(s) in this replicon]
Location [Strand]56621..57835 [+]
ProducttraW protein
Component typeTraW_I
UniProt IDQ88BS1
KEGG IDpst:PSPTO_B0067
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 404 a.a.     [Download]
>gi|29171606|ref|NP_808652.1| traW protein [Pseudomonas syringae pv. tomato str. DC3000]
MKRLYALTAIAVGVLQTQQVLAYVQPVAVTASVPITAQVMPAMAGLQATLAEILTTETQVGTAIVQASDK
QVAVISEAARAQREADIFGRQTERQERALEQYSVPDSICSESASGVAATVGKVSRAQTAVLASGAGVGSA
VVQKTIASEPVASRQGGYRSAAMHAQYCTQSESAQYGGTDLCPQVSSLPGGDIEMRSLIDGAGAVGKAPD
LTFNQDQVDAGMAYMKNSARHDGGRAPGKGDIQSATGREYQGLMTQYKAIQSAATQPQLDIIAASQANPA
TQEALQEALQNPSAAEYFASTGSQKAQRTGVMSEREFEAFEVGRRYANTAYETDLQALSGDNLMRELVRV
QSLGNWLQLGLKNDQRQANIIAGQQLALAADAKYVPQLQELGAKMSSGVTAHEN
 
Nucleotide Sequence: 1215 bp     [Download]
>gi|29171546|ref|NC_004632.1|:56621-57835 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence
ATGAAAAGACTTTATGCGTTAACAGCGATAGCCGTGGGGGTACTGCAAACACAACAGGTCCTAGCGTACG
TCCAGCCGGTGGCCGTCACGGCCAGCGTGCCCATTACGGCGCAGGTAATGCCGGCCATGGCCGGCCTTCA
AGCTACCCTGGCGGAAATCCTGACCACTGAGACACAAGTCGGCACGGCCATCGTGCAGGCCAGTGACAAA
CAGGTCGCGGTTATTTCTGAGGCCGCACGTGCCCAGCGCGAGGCCGATATTTTTGGCCGTCAGACCGAGC
GCCAGGAGCGTGCCCTAGAACAGTACTCGGTCCCTGACAGCATCTGCAGCGAGTCGGCCTCTGGGGTCGC
GGCCACGGTGGGGAAGGTGAGCCGTGCGCAAACGGCGGTTCTGGCCAGCGGGGCAGGCGTCGGCAGTGCT
GTGGTGCAGAAGACCATCGCTTCCGAGCCCGTGGCCTCGCGTCAGGGTGGCTATCGCAGTGCCGCCATGC
ACGCGCAGTACTGCACACAAAGCGAATCTGCCCAGTACGGCGGTACAGATCTGTGCCCGCAGGTCTCCAG
CTTGCCTGGAGGCGACATCGAAATGCGCTCGTTGATCGACGGGGCGGGAGCCGTGGGCAAGGCCCCTGAC
CTGACGTTCAATCAGGATCAGGTCGATGCGGGCATGGCGTACATGAAGAACTCTGCACGCCATGACGGGG
GGCGGGCACCGGGCAAGGGCGATATCCAGTCGGCCACGGGACGTGAGTATCAGGGGCTGATGACCCAGTA
CAAGGCGATTCAGAGCGCCGCGACTCAACCGCAGCTGGACATTATCGCCGCCAGTCAGGCCAATCCGGCC
ACACAGGAGGCATTGCAAGAGGCGCTACAGAATCCGTCAGCGGCGGAGTACTTCGCTTCAACGGGCAGCC
AGAAAGCACAACGCACCGGGGTGATGAGCGAGCGCGAGTTCGAGGCTTTCGAGGTGGGCAGGCGCTATGC
CAATACCGCCTATGAAACCGACCTTCAGGCCCTGAGCGGAGACAACCTGATGCGTGAGTTGGTGCGCGTG
CAGAGCCTGGGCAACTGGCTGCAGTTGGGACTCAAAAACGACCAGCGCCAGGCCAACATCATTGCCGGCC
AGCAACTGGCCTTGGCGGCAGACGCCAAATACGTTCCGCAGCTTCAGGAACTGGGAGCAAAAATGAGTTC
GGGAGTCACCGCACATGAAAACTGA
 Primer design