SecReT4
Protein ID: 29171607
T4SS name [ID]Tra_I [177]
Gene symboltraX-1
Locus tagPSPTO_B0068
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000B [GenBank: NC_004632] [Browse all T4SS(s) in this replicon]
Location [Strand]57825..58427 [+]
ProducttraX protein
Component typeTraX_I
UniProt IDQ88BS0
KEGG IDpst:PSPTO_B0068
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 200 a.a.     [Download]
>gi|29171607|ref|NP_808653.1| traX protein [Pseudomonas syringae pv. tomato str. DC3000]
MKTEPDTTKHEDEQSPPDDKHSGTPLRRAGHVGLSILNPFSDLAVIYRRGIKPTAQKLKLLKTLLTPASA
TTEADAVGVSWVQAVERSSRSVEQLVRSYQRIRAAWWCLMASGGALSLFLLIMLLLANLSLPSGTFLRAA
VTLLLLMALASWGFAQTLIATYRLWQLRERRVSVAERGTFEDFLIENRWCRQVLTLGHFG
 
Nucleotide Sequence: 603 bp     [Download]
>gi|29171546|ref|NC_004632.1|:57825-58427 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence
ATGAAAACTGAACCTGACACAACAAAGCACGAGGACGAACAATCGCCGCCGGACGACAAGCATTCGGGCA
CACCGTTACGGCGCGCCGGTCATGTGGGGCTGTCGATCCTCAACCCGTTCTCTGACCTGGCGGTGATCTA
TCGCCGGGGCATAAAACCGACGGCGCAAAAGCTGAAGCTACTGAAGACGTTGCTGACCCCGGCGTCAGCA
ACGACTGAGGCAGATGCAGTCGGTGTCAGCTGGGTACAAGCAGTCGAGCGTTCCAGCAGATCTGTTGAGC
AACTGGTGAGGTCCTACCAGCGCATTCGTGCTGCATGGTGGTGCTTGATGGCGAGTGGTGGGGCCTTGAG
CCTGTTCCTGCTGATCATGCTGCTGTTGGCAAACCTCAGCTTGCCTTCGGGCACATTCCTGCGGGCTGCG
GTGACACTGCTTTTATTGATGGCTCTGGCCAGTTGGGGGTTTGCGCAGACGCTAATCGCCACTTACCGGC
TATGGCAGTTGCGGGAACGGCGCGTCAGCGTAGCGGAACGAGGCACCTTTGAAGATTTCCTCATCGAAAA
CCGATGGTGCCGGCAGGTACTGACGCTCGGTCACTTCGGCTAA
 Primer design