SecReT4
Protein ID: 29171608
T4SS name [ID]Tra_I [177]
Gene symboltraY-1
Locus tagPSPTO_B0069
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000B [GenBank: NC_004632] [Browse all T4SS(s) in this replicon]
Location [Strand]58458..60602 [+]
ProducttraY protein
Component typeTraY_I
UniProt IDQ88BR9
KEGG IDpst:PSPTO_B0069
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 714 a.a.     [Download]
>gi|29171608|ref|NP_808654.1| traY protein [Pseudomonas syringae pv. tomato str. DC3000]
MNLLKRFWWVGLLLVFSVPAMADSVDYQTIAAAAQKPNDLSRQALVMIFGQVAVDPFAPSQPTLIGSLFA
IINGFLAVLAMFWFLTITMKTIVKAGHQGQFFAGGRSALYPIMTFGGFIMILPTQSGWSLAQLVMLWATS
TMGIGSANLLTDKAVDMMDSGYSMVTQPTAPVTRGAARGIFEMNLCKYAINRELQALYGDGEANTPLITT
KGGNGQYDTGNGSAVCGSAKTPNTGRTGTWNLLFDSDVDTSGVITAQHQALDTMQSTLDQAAQAFVDTYL
SKRDQDVGSFQDAETQIQNAAAAYENTVNQAINKIDFKDTLQSQLSSQIKSSGWVALGSWYHTFATANNK
TNDVASSTPVVTGMSNLGEHGTGDLYNQVFAAYKSQVQNSTYTAPLGTQTAKDDGAAATAKDPNSVFVNV
FKSPMQGLTNFFATKRVGTEADFSNQVNPLIKMQTIGDYTLGVTETLMAAYAGTWAAASSASNSPLGWGA
KIFAVDLGAVVKDVLGALAPMFYFVMFALLAIGFSLAVFLPAVPFLFWMMGVFNWVVSVLVGCAAGPMWA
ATHLGAEEDKGSRSAYGYIFLIDMMLRPSLMVLGFFFASVAVAAGGTILNLLFASALANANADSIMGLFK
MIGWLMIYARIATFGVTRLFGLQASLADYVISFLGGREGANLMGGMVDNMKGMFGAAGSGAQRTPGVKMQ
PRKPGAGGHGDGIQ
 
Nucleotide Sequence: 2145 bp     [Download]
>gi|29171546|ref|NC_004632.1|:58458-60602 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence
ATGAACCTCCTAAAACGCTTTTGGTGGGTCGGTTTACTGCTGGTCTTTTCTGTGCCGGCAATGGCCGACA
GTGTGGATTATCAGACCATCGCAGCGGCTGCCCAAAAGCCCAATGACCTCTCGCGCCAGGCGCTGGTGAT
GATTTTTGGGCAAGTAGCAGTCGATCCATTTGCACCCTCACAGCCAACACTGATTGGCTCACTGTTCGCC
ATTATCAATGGCTTTCTGGCTGTGCTGGCCATGTTCTGGTTTCTGACCATCACCATGAAAACCATCGTGA
AGGCCGGGCATCAGGGACAGTTTTTCGCAGGCGGTCGATCTGCGCTGTACCCGATCATGACGTTCGGCGG
CTTCATCATGATTCTGCCCACGCAATCGGGTTGGTCACTGGCCCAGCTGGTCATGCTCTGGGCTACCTCT
ACGATGGGTATTGGCAGTGCCAATCTGTTGACCGATAAAGCCGTGGACATGATGGACAGCGGCTACTCGA
TGGTGACGCAACCTACGGCCCCGGTGACCCGAGGCGCGGCACGCGGCATCTTCGAAATGAACCTGTGCAA
GTACGCGATCAACCGTGAGCTGCAAGCGCTTTACGGGGACGGCGAAGCCAATACCCCGTTGATTACCACC
AAGGGGGGCAACGGCCAATACGACACCGGCAACGGCAGCGCGGTATGTGGTTCTGCCAAAACACCCAACA
CGGGCCGCACCGGGACCTGGAACCTGTTGTTTGACAGTGACGTGGACACGAGTGGGGTGATCACGGCGCA
GCACCAAGCGCTAGACACCATGCAGAGTACCCTGGATCAAGCGGCACAGGCGTTCGTAGACACCTACCTG
AGCAAGCGTGACCAGGACGTGGGGAGTTTTCAGGACGCCGAAACGCAGATCCAGAACGCAGCCGCCGCCT
ATGAAAACACGGTGAACCAGGCGATCAACAAGATCGACTTCAAGGACACGCTACAGAGCCAGCTTTCAAG
CCAGATCAAAAGCAGTGGTTGGGTGGCTCTGGGCAGTTGGTATCACACCTTTGCCACAGCCAATAACAAG
ACCAATGATGTGGCCAGCTCGACTCCGGTTGTCACGGGGATGAGCAACCTGGGCGAGCACGGTACTGGCG
ATTTGTATAACCAGGTGTTTGCGGCCTACAAATCGCAGGTGCAAAACAGTACCTACACGGCTCCGCTAGG
GACGCAGACGGCCAAGGATGATGGCGCGGCAGCGACGGCGAAGGACCCGAATTCGGTGTTTGTAAACGTT
TTCAAATCGCCCATGCAGGGGCTTACCAATTTTTTTGCCACTAAGCGCGTCGGTACCGAGGCAGACTTTT
CGAACCAAGTGAACCCGCTTATCAAGATGCAAACAATTGGTGACTACACGTTAGGAGTTACAGAAACACT
TATGGCTGCCTATGCCGGAACTTGGGCCGCCGCCTCATCGGCCAGCAACTCGCCGTTGGGCTGGGGGGCC
AAAATATTTGCGGTAGATTTAGGGGCGGTTGTGAAAGACGTGCTGGGCGCGCTTGCACCGATGTTTTATT
TCGTCATGTTCGCCCTGCTGGCCATCGGTTTTTCGCTGGCCGTATTTCTGCCTGCTGTGCCCTTCCTGTT
CTGGATGATGGGGGTATTCAACTGGGTCGTCAGTGTGCTGGTGGGATGTGCGGCTGGGCCGATGTGGGCT
GCGACGCACTTGGGCGCAGAGGAAGACAAGGGCAGCCGTAGTGCCTACGGTTATATCTTCCTGATCGACA
TGATGCTGCGGCCGTCGTTGATGGTACTGGGGTTCTTTTTCGCTTCGGTGGCCGTAGCCGCAGGGGGAAC
GATCCTGAATCTGTTATTCGCCTCGGCGCTGGCCAATGCCAACGCAGACTCGATAATGGGGCTGTTCAAG
ATGATTGGGTGGCTGATGATCTATGCCCGCATTGCGACCTTTGGTGTGACTCGGCTCTTTGGCCTGCAGG
CGTCCCTGGCGGACTACGTGATCTCGTTTCTAGGAGGCCGAGAAGGGGCAAACCTGATGGGCGGCATGGT
CGATAACATGAAAGGCATGTTTGGTGCTGCTGGCTCTGGGGCACAACGTACCCCTGGCGTTAAAATGCAA
CCTAGGAAGCCTGGCGCAGGGGGGCATGGGGATGGAATTCAATAG
 Primer design