SecReT4
Protein ID: 29171611
T4SS name [ID]Tra_I [177]
Gene symbol-
Locus tagPSPTO_B0072
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000B [GenBank: NC_004632] [Browse all T4SS(s) in this replicon]
Location [Strand]61687..62889 [+]
Producthypothetical protein
Component typeTrbA_I
UniProt IDQ88BR6
KEGG IDpst:PSPTO_B0072
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 400 a.a.     [Download]
>gi|29171611|ref|NP_808657.1| hypothetical protein PSPTO_B0072 [Pseudomonas syringae pv. tomato str. DC3000]
MQNRQSQGAWEGEQAQMLLALCAAVLLCWMFFDIFVYWTTWTLYWLWKMVDFPFIHAWAGGKINLLADVA
NHAKAVTLDEWLEVMNATSGILLLFLIPLVIVSSWGLAQHPVLPFRSKRLVNIHTLPGLVSRFAPSVIPV
LAASGPDGLMNDTSPSNAWALKPEEFAERYNLVQRKVLDREAARAVFEEQVGDVHDGLLDLTPYERALLA
VFGLQVFLNDRKAATRLLDDLNRSCMIKGLLRRKTFSLTPLYGLADAGFDRVAKAPGVSEWLQSHRSMRT
ALVALYGRDLRLAPARFRWLKGVNRTLWYALHSADTAKVFVEGAGVQAQARAEVHARKLGLPRPGLMVTQ
AIDGLQAELESIGLVFARHVITPKRREASDLPVMTAVYAAQPPVGDEPSE
 
Nucleotide Sequence: 1203 bp     [Download]
>gi|29171546|ref|NC_004632.1|:61687-62889 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence
ATGCAAAATCGACAATCCCAAGGTGCATGGGAGGGTGAGCAAGCGCAGATGTTATTGGCGCTTTGTGCAG
CCGTCCTGTTGTGCTGGATGTTCTTCGATATCTTCGTGTACTGGACCACCTGGACGCTCTATTGGTTATG
GAAAATGGTGGATTTTCCCTTCATCCATGCCTGGGCCGGTGGCAAGATCAACCTGCTGGCCGACGTGGCC
AACCACGCCAAGGCCGTGACGCTGGATGAATGGCTTGAGGTGATGAACGCCACCAGTGGGATTCTGCTGC
TGTTCTTGATACCGCTGGTGATTGTGAGCAGTTGGGGGCTGGCGCAGCATCCGGTACTGCCGTTTCGCAG
TAAACGCCTGGTGAACATTCACACCCTTCCTGGCCTGGTGAGTCGTTTCGCACCCTCGGTCATCCCGGTG
TTGGCTGCGTCTGGTCCCGATGGCCTGATGAACGATACCTCTCCCAGCAATGCGTGGGCGCTAAAGCCCG
AGGAGTTTGCTGAACGTTACAACCTGGTGCAGCGCAAAGTGCTGGATCGGGAGGCCGCTCGTGCGGTGTT
CGAGGAGCAGGTCGGAGATGTTCATGATGGCCTTCTGGACTTGACACCCTATGAACGGGCCTTGCTGGCC
GTATTCGGTCTGCAGGTTTTCCTCAATGACCGCAAGGCAGCGACCCGGTTGCTCGATGACCTGAACCGTT
CCTGCATGATCAAGGGGTTGTTGCGGCGCAAGACCTTCTCGTTGACGCCGCTGTACGGCTTGGCCGATGC
GGGGTTTGATCGCGTTGCAAAAGCACCGGGCGTCAGTGAGTGGCTGCAAAGCCATAGATCGATGCGCACC
GCGCTGGTGGCCTTGTATGGCCGCGATCTGCGCTTGGCGCCGGCGCGCTTTCGCTGGCTCAAGGGGGTTA
ACCGTACTTTGTGGTATGCCCTGCACAGTGCCGACACGGCCAAGGTGTTTGTGGAAGGCGCCGGTGTTCA
GGCTCAGGCGCGGGCAGAAGTCCATGCCAGAAAGCTGGGGCTGCCACGTCCTGGGTTGATGGTGACCCAG
GCCATCGATGGCTTGCAGGCCGAGTTGGAAAGCATCGGTCTGGTATTTGCGCGACATGTCATCACGCCTA
AACGCCGGGAGGCCTCTGACCTTCCTGTCATGACGGCGGTGTATGCCGCGCAGCCACCTGTGGGTGATGA
GCCTAGTGAGTAG
 Primer design