SecReT4
Protein ID: 29171614
T4SS name [ID]Tra_I [177]
Gene symbol-
Locus tagPSPTO_B0075
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000B [GenBank: NC_004632] [Browse all T4SS(s) in this replicon]
Location [Strand]63546..64631 [+]
ProducttrbB protein, putative
Component typeTrbB_I
UniProt IDQ88BR3
KEGG IDpst:PSPTO_B0075
PDB IDNA
Domain hit(s) vs Pfam Thioredoxin_2 [PF13098], Evalue: 4.3e-08, Aligned region: 197..328
Protein Sequence: 361 a.a.     [Download]
>gi|29171614|ref|NP_808660.1| trbB protein, putative [Pseudomonas syringae pv. tomato str. DC3000]
MASASLRAPFSVDIQGDQLVVYQADQEAGIVTRTICTLDLRHQHSFYLSNDGVVCRDVQGFEFSLETHDS
NETHELLTALSRALLRHGRRKTQRRLMGVFVLLVVLCLGAPWLGRALELPVVMPAAQVITPSVTSPPKPD
LAKRSAPAPIASEPRQSAADVAPDDGWTLPREVRATLPQKLHNAAERKLFTVDYSSGHARTLYVFSDPGC
PNCQRLESSLNTLSDAFNVVVFPVPVIGKEKSIAAITPVLCLPPEQRKTPWDRLFDAAPEGVNLGKPPLK
PASEGVELKAAQPAGTCDVAEKALGINQTAYQAYRIPGTPWVISDDGRYVPQALLRDPIRLKAFLDERPA
RQVQEVSNAPQ
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|29171546|ref|NC_004632.1|:63546-64631 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence
ATGGCCTCGGCATCTTTACGCGCCCCGTTTTCGGTGGACATCCAAGGCGATCAGCTGGTTGTCTATCAGG
CAGATCAGGAAGCAGGCATCGTGACACGCACGATTTGCACCCTGGACCTTCGCCATCAGCACTCGTTTTA
TTTGAGCAATGACGGTGTGGTCTGCCGCGATGTTCAGGGTTTTGAATTCTCACTTGAAACCCATGACAGT
AACGAAACCCATGAGCTACTGACCGCACTGTCGCGGGCTTTGCTGCGTCATGGACGACGCAAGACCCAGC
GGCGTCTGATGGGCGTGTTCGTGCTGTTGGTTGTGCTTTGCCTCGGTGCCCCATGGCTTGGCCGAGCGCT
TGAATTGCCTGTTGTAATGCCGGCGGCGCAGGTCATCACGCCCTCAGTCACGAGCCCCCCCAAGCCGGAC
CTGGCCAAGCGCAGCGCGCCGGCGCCGATCGCTTCTGAGCCACGCCAGTCCGCTGCAGACGTGGCACCTG
ACGATGGCTGGACATTGCCCAGGGAGGTTCGGGCCACACTCCCTCAAAAGCTGCACAACGCTGCCGAGCG
CAAGCTGTTCACCGTTGACTATTCCAGCGGTCACGCGCGCACGCTGTATGTCTTTTCGGACCCTGGCTGC
CCGAACTGCCAGCGTCTGGAGTCGTCCCTCAACACGCTCTCCGACGCCTTCAACGTGGTGGTGTTTCCTG
TGCCGGTGATTGGTAAGGAAAAGTCGATCGCCGCCATTACGCCGGTGCTGTGCCTGCCGCCTGAGCAGCG
CAAAACCCCGTGGGATCGCCTGTTTGATGCAGCCCCTGAGGGTGTGAACCTTGGGAAACCCCCGTTAAAG
CCGGCGTCGGAAGGGGTGGAGTTGAAAGCGGCGCAACCAGCAGGCACGTGCGATGTTGCAGAAAAGGCCT
TGGGGATCAACCAGACGGCCTATCAGGCGTATCGCATACCGGGCACGCCCTGGGTGATCAGCGACGATGG
GCGCTATGTGCCGCAGGCGTTGTTGCGTGATCCGATCAGGCTCAAAGCCTTCCTAGATGAGCGACCTGCC
CGCCAGGTTCAGGAGGTGTCGAATGCGCCCCAATGA
 Primer design