SecReT4
Protein ID: 29171615
T4SS name [ID]Tra_I [177]
Gene symboltrbC
Locus tagPSPTO_B0076
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconplasmid pDC3000B [GenBank: NC_004632] [Browse all T4SS(s) in this replicon]
Location [Strand]64618..66906 [+]
ProducttrbC protein
Component typeTrbC_I
UniProt IDQ88BR2
KEGG IDpst:PSPTO_B0076
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 2.3e-09, Aligned region: 137..512
TraG-D_C [PF12696], Evalue: 2.3e-05, Aligned region: 437..518
Protein Sequence: 762 a.a.     [Download]
>gi|29171615|ref|NP_808661.1| trbC protein [Pseudomonas syringae pv. tomato str. DC3000]
MRPNDYAVERTRLNRRVYHSALAEWLMGPGSLTLGLAGSVVGGVLYPVSLWLSLPALLVWSPVMLLEPWQ
MPMRMPSDMDCLDPSTQRQVTGKLLGFLPVTAMRTVMLKAAGILYMGYLRGRDAGRELWLSLDDMTRHIL
MFGTTGAGKTEALLGYVLGQLGYGKGLIYSDGKAQNDVAAAIVSLARRFGREDDVRMMNFITGGRSRAQE
LLEDNKSRGQTNTVNAFGIAQETYIINLMDSMLPPAGNDAGWQEKARAMIQALVFSLVYKCRREGTVMSQ
RTIQAHLPLRAIAKLYIQSVEQQWHEDAQLPLKNYLGTLSGFDLAKVDSPEEWATTALDQHGFLIQQFTR
MLALFNDTYGHVFARDAGDIDLKDVVHNDRILVVLIPALEISSTEAATLGRLYVSQLAMILSQDLGEKLE
GKPEDILVIRKYKDRFPFLWICDEVGAYYTEKLGELATQVRSLGFCLLLASQEAQRLKSAAGDKVWTLIG
NMGVRITGKIMDPKDTLEILQLMAGTEYLPVMSGMVRQAGIMGASWEEADTLSLKDEKKVSVEEVQQLKE
GENITLFNGQVIRGSSLYIHDADKLSKEAIRINRFIEVAPPALDTLLAGAPARIRRSYPRADRVQQILYH
LAMKPGRSDLENLVLTDPTLVVLNELGEEWRLIWRRRPGAAVRSTLLWHTALEHVPKRGSGYVAQSSTAL
DLTVGSKRLQAYQAQHIDPARAPKVKGKAPAPRATTPVPPRHDHSPPYFDDGSYSPAPFDWD
 
Nucleotide Sequence: 2289 bp     [Download]
>gi|29171546|ref|NC_004632.1|:64618-66906 Pseudomonas syringae pv. tomato str. DC3000 plasmid pDC3000B, complete sequence
ATGCGCCCCAATGACTACGCCGTCGAGCGCACGCGCCTAAATCGGCGGGTTTACCACTCGGCACTGGCTG
AGTGGTTGATGGGCCCCGGTAGTCTGACGCTGGGCCTTGCCGGGTCTGTGGTGGGAGGCGTCCTGTACCC
GGTCAGCCTGTGGCTCAGTCTGCCGGCCTTGCTGGTTTGGTCACCTGTCATGCTGCTCGAACCCTGGCAG
ATGCCCATGCGCATGCCTTCAGACATGGACTGCCTCGACCCTTCGACGCAACGCCAGGTGACGGGCAAGC
TGCTGGGTTTCTTGCCGGTCACGGCCATGCGCACGGTGATGCTCAAGGCAGCGGGCATCCTGTATATGGG
GTACCTGCGCGGTCGGGACGCCGGGCGTGAACTGTGGCTGTCGCTGGATGACATGACCCGCCATATTCTG
ATGTTCGGTACAACCGGTGCCGGCAAAACCGAAGCACTGCTGGGGTACGTGTTGGGCCAGCTGGGCTATG
GAAAGGGCCTGATTTATTCGGACGGCAAGGCCCAAAATGATGTGGCCGCCGCGATCGTGTCGCTGGCCCG
ACGCTTTGGCCGTGAAGACGACGTTCGGATGATGAACTTCATTACCGGGGGCCGCTCCAGGGCACAGGAA
CTGCTGGAGGACAACAAAAGCAGAGGGCAGACCAATACCGTCAACGCGTTCGGTATTGCTCAGGAAACCT
ACATCATCAACCTGATGGATTCGATGTTGCCTCCTGCGGGCAACGATGCCGGCTGGCAAGAGAAAGCCCG
GGCCATGATTCAGGCTTTGGTGTTCTCCCTGGTGTACAAGTGCCGGCGTGAAGGCACGGTCATGTCCCAG
CGCACGATCCAGGCACATTTGCCGTTGCGGGCCATTGCCAAGCTCTACATCCAGTCGGTGGAACAGCAAT
GGCATGAAGACGCCCAGTTACCCCTGAAAAACTACCTGGGCACATTGTCCGGTTTTGACCTGGCCAAGGT
GGATTCGCCGGAGGAATGGGCGACCACTGCGTTGGATCAGCATGGTTTTCTGATCCAGCAGTTCACCCGC
ATGCTGGCCTTGTTCAATGACACCTACGGCCATGTGTTTGCCCGTGACGCCGGCGACATAGACCTCAAGG
ACGTGGTGCATAACGATCGCATCCTGGTGGTCCTGATTCCTGCGCTGGAAATCTCCTCGACCGAGGCCGC
GACCCTTGGGCGTCTGTACGTGTCGCAATTGGCCATGATCCTGAGCCAGGATCTGGGGGAGAAACTGGAG
GGCAAACCCGAAGACATCCTGGTGATCCGCAAGTACAAGGACCGCTTTCCGTTCTTGTGGATCTGCGACG
AGGTCGGGGCCTACTACACCGAAAAGCTCGGCGAGCTGGCCACGCAAGTACGCTCCCTGGGGTTTTGCCT
GCTCCTGGCCAGTCAGGAGGCGCAGCGCCTCAAGTCGGCGGCCGGCGACAAGGTGTGGACGCTGATCGGG
AACATGGGGGTCCGAATCACCGGCAAGATCATGGACCCCAAGGACACTCTCGAAATACTGCAGTTGATGG
CCGGTACCGAGTACCTGCCAGTGATGAGCGGTATGGTGCGTCAGGCCGGAATCATGGGGGCCAGCTGGGA
GGAAGCAGACACACTGAGCCTGAAAGATGAGAAGAAAGTCAGCGTCGAGGAAGTGCAGCAGCTCAAGGAG
GGGGAAAACATCACGCTGTTCAACGGACAAGTGATTCGCGGCAGCTCCTTGTACATTCACGATGCTGACA
AGCTGTCCAAGGAAGCGATCCGGATCAACCGCTTCATCGAGGTGGCCCCGCCAGCGCTGGACACCTTGTT
GGCCGGTGCGCCTGCCCGCATTCGGCGCAGCTATCCGCGCGCGGACCGCGTGCAGCAGATCCTGTACCAC
CTGGCGATGAAGCCTGGCCGTTCAGACCTTGAAAACCTGGTGCTGACAGATCCGACGTTGGTCGTCTTGA
ACGAGCTGGGAGAAGAGTGGCGGCTGATCTGGCGTCGCCGTCCTGGAGCGGCAGTGCGCAGCACCTTGTT
ATGGCACACAGCGCTGGAGCATGTGCCCAAGCGCGGAAGCGGCTACGTGGCGCAATCGTCCACGGCGCTG
GATCTGACCGTCGGCAGCAAGCGGTTGCAGGCCTACCAGGCGCAGCACATCGATCCGGCCAGAGCGCCGA
AAGTGAAGGGCAAGGCGCCTGCACCTAGAGCCACAACGCCTGTTCCACCACGCCACGACCATTCACCGCC
CTATTTCGACGACGGATCGTATTCGCCGGCGCCGTTCGACTGGGATTAA
 Primer design