SecReT4
Protein ID: 293386481
T4SS name [ID]Tra_I [175]
Gene symboltraH
Locus tagEAM_P262
StrainErwinia amylovora ATCC 49946
Repliconplasmid 2 [GenBank: NC_013973] [Browse all T4SS(s) in this replicon]
Location [Strand]42879..43358 [+]
Productconjugal transfer protein
Component typeTraH_I
UniProt IDD4IGU8
KEGG IDeay:EAM_P262
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 159 a.a.     [Download]
>gi|293386481|ref|YP_003540643.1| conjugal transfer protein [Erwinia amylovora ATCC 49946]
MKKRIITVLPALLLCGCQLNPQPPASIAPTAQNLNTPPKTSLQLTQLWMEGDLAANTPLPVAAIRADSDR
VTFSWNGDAVELLNALARARGQGFSYTGVRLPLPIDIEVQGATYANVLRMIQMQTSWRATLATYPGQMVL
QFMPSVPAVPVSHGRGNRR
 
Nucleotide Sequence: 480 bp     [Download]
>ref|NC_013973.1|:42879-43358 conjugal transfer protein [Erwinia amylovora ATCC 49946]
ATGAAAAAACGCATTATCACCGTGCTGCCGGCGCTGCTGCTGTGTGGCTGCCAGCTGAACCCGCAACCAC
CTGCAAGCATCGCGCCAACTGCCCAAAACCTGAACACGCCGCCTAAAACTTCTCTACAGCTTACACAGCT
CTGGATGGAGGGCGACCTTGCTGCCAACACGCCGCTGCCGGTGGCGGCCATTCGTGCTGACAGCGATCGC
GTGACCTTCAGTTGGAACGGTGACGCGGTAGAGCTCCTGAACGCGCTCGCCCGCGCACGTGGTCAGGGCT
TCAGTTATACCGGCGTGCGTCTGCCGCTGCCCATCGACATCGAGGTGCAAGGTGCCACATACGCAAACGT
GCTGCGCATGATCCAGATGCAAACCAGCTGGCGCGCAACGCTCGCAACATACCCGGGGCAGATGGTGCTG
CAATTCATGCCGTCTGTTCCGGCAGTTCCGGTTAGTCATGGCAGGGGGAACAGACGATGA
 Primer design