SecReT4
Protein ID: 293386482
T4SS name [ID]Tra_I [175]
Gene symboltraI
Locus tagEAM_P263
StrainErwinia amylovora ATCC 49946
Repliconplasmid 2 [GenBank: NC_013973] [Browse all T4SS(s) in this replicon]
Location [Strand]43355..44179 [+]
Productconjugal transfer protein
Component typeTraI_I
UniProt IDD4IGU9
KEGG IDeay:EAM_P263
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 274 a.a.     [Download]
>gi|293386482|ref|YP_003540644.1| conjugal transfer protein [Erwinia amylovora ATCC 49946]
MKTRLCILLLPALLAGCAGFHFTQTVPATGPDGAPPPGPEAYLSPKKQDASNVSDNRRQMLTEGGRTTGF
RGGKAQRAWELRRDLDARAKQLDATYDFRPLISSRGWLPPVITEATDVAHVTPDQIRTASRVYEIIQPER
FVSNPPTWRSWLMAGLSTVPPDEPTGGLVPENGVQRDIWQAAVNEGWAEGRQSADETLEANVNRLTRDYN
GMLTYILLRRQNLITAPVVTERQQTVTGNSNKLTTGDRERRLDSRAGFVTDKSKWEPVINTEKH
 
Nucleotide Sequence: 825 bp     [Download]
>ref|NC_013973.1|:43355-44179 conjugal transfer protein [Erwinia amylovora ATCC 49946]
ATGAAAACCCGACTCTGCATCCTGCTGCTGCCCGCGCTGCTGGCGGGCTGCGCGGGATTTCATTTCACGC
AGACAGTGCCCGCAACCGGCCCTGACGGCGCTCCGCCGCCCGGACCTGAGGCTTACCTGTCGCCCAAAAA
ACAGGATGCGTCGAACGTCTCTGATAACCGCCGGCAAATGCTTACCGAAGGCGGACGTACGACCGGTTTT
CGTGGCGGTAAGGCGCAGCGAGCGTGGGAGCTACGCCGCGATCTGGACGCGCGCGCCAAGCAACTCGATG
CCACTTATGACTTCCGCCCGCTTATCAGCAGCCGCGGATGGCTTCCGCCGGTCATCACAGAAGCCACCGA
CGTGGCGCACGTTACGCCCGATCAGATACGCACCGCGAGCCGAGTGTACGAAATTATTCAGCCCGAACGC
TTTGTCAGTAATCCACCAACGTGGCGCAGCTGGCTCATGGCCGGGCTGAGTACCGTCCCTCCGGATGAAC
CGACGGGCGGGCTCGTACCTGAAAACGGCGTGCAGCGGGACATATGGCAGGCAGCAGTGAATGAGGGCTG
GGCTGAGGGGCGGCAGAGCGCTGACGAGACGCTGGAGGCCAACGTCAACAGGCTCACCCGCGACTATAAC
GGGATGCTCACTTACATCCTGCTGCGCCGGCAGAACCTCATCACTGCGCCGGTAGTTACAGAGCGACAGC
AGACTGTTACCGGCAATAGTAACAAGCTCACAACCGGCGATCGCGAGCGACGTCTTGACTCGCGGGCGGG
CTTCGTGACTGACAAATCGAAGTGGGAACCAGTTATTAATACGGAGAAACATTAA
 Primer design