SecReT4
Protein ID: 293386483
T4SS name [ID]Tra_I [175]
Gene symboltraJ
Locus tagEAM_P264
StrainErwinia amylovora ATCC 49946
Repliconplasmid 2 [GenBank: NC_013973] [Browse all T4SS(s) in this replicon]
Location [Strand]44179..45336 [+]
Productconjugal transfer protein
Component typeTraJ_I
UniProt IDD4IGV0
KEGG IDeay:EAM_P264
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.8e-24, Aligned region: 25..296
Protein Sequence: 385 a.a.     [Download]
>gi|293386483|ref|YP_003540645.1| conjugal transfer protein [Erwinia amylovora ATCC 49946]
MSAEFPPFDFSSGLNADTLRCFMVWCARYHVSDIHLQGDNNFVVGRYGRLLRASPFSVADDSMSKLMDDI
FSPEMRPKVRGGVSIDRALQLDGDANKRWGLDRGERVRFRVNLLQGTAGRQKTIGWTMRVIPSEIPPLKN
MGLDPELMENILPEKGLALWGGITGSGKSTALASTYRYSLDTYPDRKVTTKEDPIEFILGRPDDVLPPLQ
SQVGEDIPDFATGIRADLRRAPSIMGVGEMRDRETIEAGIRAGQLGHLCLSTTHIDSPGEVFARLLMEFP
HESRDAMAWALLGVLQYVVVQTLLRTTDGKRTAVREYIVIDHALREKLGGMPWSQWGAHVNSIIRLEKRR
IVDQAWRLCVEGRIAPAELSMVMSPSQRREFEVAA
 
Nucleotide Sequence: 1158 bp     [Download]
>ref|NC_013973.1|:44179-45336 conjugal transfer protein [Erwinia amylovora ATCC 49946]
ATGTCAGCAGAATTCCCCCCCTTTGACTTCAGCAGTGGCCTGAACGCCGACACGCTGCGCTGCTTTATGG
TCTGGTGCGCACGCTATCATGTAAGCGACATTCACCTGCAGGGCGACAATAATTTTGTGGTTGGTCGTTA
CGGCCGGCTGCTACGCGCAAGCCCATTTTCCGTAGCTGATGACTCTATGTCCAAGCTGATGGATGACATA
TTTTCTCCGGAGATGCGCCCTAAAGTGCGCGGGGGAGTATCAATAGACCGTGCGCTGCAGCTCGACGGCG
ATGCAAACAAGCGCTGGGGCCTGGATCGCGGTGAGCGAGTCCGCTTTCGCGTGAACCTGCTGCAGGGTAC
GGCGGGGCGTCAGAAAACGATAGGCTGGACGATGCGGGTTATCCCGTCAGAAATCCCGCCGCTTAAAAAT
ATGGGACTTGATCCGGAGCTGATGGAAAACATTTTGCCGGAAAAAGGCCTTGCCTTATGGGGTGGCATTA
CCGGATCCGGCAAAAGCACGGCGCTTGCTTCTACGTACCGGTACAGTCTGGACACCTATCCGGACCGAAA
AGTCACAACGAAAGAAGATCCGATTGAATTCATCCTCGGGCGTCCGGACGATGTTTTGCCGCCGCTGCAG
TCGCAGGTGGGTGAAGACATTCCGGATTTTGCAACTGGTATCCGCGCTGACCTGCGCCGTGCGCCGTCGA
TTATGGGCGTAGGTGAAATGCGCGACCGCGAAACTATCGAAGCCGGTATCCGCGCCGGACAGCTTGGTCA
CTTATGCCTTTCCACAACCCATATCGACTCACCCGGCGAGGTGTTTGCTCGCCTGCTTATGGAATTCCCG
CATGAAAGCCGCGATGCCATGGCGTGGGCGCTGCTGGGCGTACTGCAGTATGTTGTGGTGCAAACGCTGT
TACGTACCACAGATGGAAAGCGCACGGCCGTCCGTGAATACATTGTTATTGACCATGCCCTGCGTGAAAA
GCTGGGCGGCATGCCCTGGTCACAATGGGGCGCACACGTAAACAGCATTATCCGGTTGGAGAAACGCCGC
ATCGTGGATCAAGCCTGGCGGCTCTGTGTTGAGGGCCGTATTGCTCCCGCAGAACTCAGTATGGTGATGT
CTCCAAGCCAGCGTCGCGAGTTTGAGGTGGCGGCATGA
 Primer design