SecReT4
Protein ID: 293386484
T4SS name [ID]Tra_I [175]
Gene symboltraK
Locus tagEAM_P265
StrainErwinia amylovora ATCC 49946
Repliconplasmid 2 [GenBank: NC_013973] [Browse all T4SS(s) in this replicon]
Location [Strand]45333..45623 [+]
Productconjugal transfer protein
Component typeTraK_I
UniProt IDD4IGV1
KEGG IDeay:EAM_P265
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 96 a.a.     [Download]
>gi|293386484|ref|YP_003540646.1| conjugal transfer protein [Erwinia amylovora ATCC 49946]
MSDRMKENYPPGYWRAAGKSLTFLGIPAWLFLLYLFWFRFPCMETLYIVSGVIAVFRLLKMLGWGVTEML
RRLARLARGKSLSGRPWWYRRFTDGE
 
Nucleotide Sequence: 291 bp     [Download]
>ref|NC_013973.1|:45333-45623 conjugal transfer protein [Erwinia amylovora ATCC 49946]
ATGAGTGACCGCATGAAAGAAAATTATCCCCCGGGTTACTGGCGCGCGGCAGGCAAAAGCCTGACTTTTT
TAGGCATCCCCGCCTGGTTATTTCTGCTTTATCTCTTCTGGTTTCGTTTCCCCTGTATGGAGACGCTTTA
TATCGTTTCTGGCGTGATAGCGGTTTTTCGCCTGCTGAAAATGCTTGGCTGGGGCGTGACCGAAATGCTC
AGACGCCTTGCTCGTCTTGCCCGCGGTAAGTCACTGAGCGGGCGCCCATGGTGGTATCGCCGTTTTACCG
ATGGCGAGTAG
 Primer design