SecReT4
Protein ID: 293386486
T4SS name [ID]Tra_I [175]
Gene symboltraL
Locus tagEAM_P267
StrainErwinia amylovora ATCC 49946
Repliconplasmid 2 [GenBank: NC_013973] [Browse all T4SS(s) in this replicon]
Location [Strand]50578..50925 [+]
Productconjugal transfer protein
Component typeTraL_I
UniProt IDD4IGV3
KEGG IDeay:EAM_P267
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 115 a.a.     [Download]
>gi|293386486|ref|YP_003540648.1| conjugal transfer protein [Erwinia amylovora ATCC 49946]
MKKIPTAFMAVFLCFASFTTSAASCRAASAAQAGSEAGYNAARKASDAWSQRESQMSDQMQNCLSGIRDI
SVSLPHLPSLQDIMNQASEKVCSAMTDKINSYLPDNIDPWQSYGM
 
Nucleotide Sequence: 348 bp     [Download]
>ref|NC_013973.1|:50578-50925 conjugal transfer protein [Erwinia amylovora ATCC 49946]
ATGAAAAAAATCCCGACCGCCTTTATGGCGGTCTTTTTATGCTTCGCGTCCTTTACGACCAGTGCGGCGA
GCTGCCGCGCTGCGTCTGCAGCACAAGCTGGCAGTGAAGCGGGCTATAACGCCGCGAGGAAGGCCAGCGA
TGCCTGGTCACAACGTGAAAGTCAGATGTCAGATCAAATGCAGAATTGTCTTTCCGGCATTCGGGATATT
TCCGTAAGCCTGCCGCACTTGCCCAGCCTGCAAGACATCATGAATCAGGCGTCAGAGAAGGTCTGCAGTG
CAATGACCGACAAGATCAACAGCTATCTGCCCGACAATATCGACCCGTGGCAGTCCTACGGCATGTAA
 Primer design