SecReT4
Protein ID: 293386487
T4SS name [ID]Tra_I [175]
Gene symboltraM
Locus tagEAM_P268
StrainErwinia amylovora ATCC 49946
Repliconplasmid 2 [GenBank: NC_013973] [Browse all T4SS(s) in this replicon]
Location [Strand]50936..51628 [+]
Productconjugal transfer protein
Component typeTraM_I
UniProt IDD4IGV4
KEGG IDeay:EAM_P268
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 1.5e-30, Aligned region: 80..187
Protein Sequence: 230 a.a.     [Download]
>gi|293386487|ref|YP_003540649.1| conjugal transfer protein [Erwinia amylovora ATCC 49946]
MQNPVAAQPPDVSAPVLSNPDIYEHAVQAQHERTLGAEFARKCLKGLGWSQVLNVIQAITIGLLFWAYIH
LPQHYVSTENGRITPFYPTDKPVWSESDVRQFGADTISKAFTLDFVHYRDQMTAVSPDFSEEGFAGYNQA
LTTGSNILSLVKDKRMNLTNTVEPGVIARRGVIGDRYTWEFQYPVTMRLQGQNSSSPPLRYIFTLRIQQA
DVRRKPRGLEVTQTITNNAG
 
Nucleotide Sequence: 693 bp     [Download]
>ref|NC_013973.1|:50936-51628 conjugal transfer protein [Erwinia amylovora ATCC 49946]
ATGCAAAACCCTGTAGCGGCTCAGCCGCCTGATGTTTCCGCTCCTGTCCTGAGTAATCCGGATATTTATG
AGCATGCCGTTCAGGCTCAGCATGAGCGCACGCTGGGTGCTGAGTTCGCCCGCAAATGCCTGAAAGGTTT
AGGCTGGAGTCAGGTACTCAACGTTATCCAGGCGATCACTATCGGCTTGCTCTTTTGGGCCTATATACAT
CTGCCGCAGCACTACGTCTCTACGGAAAACGGCCGCATTACGCCTTTCTACCCGACGGACAAGCCGGTCT
GGAGCGAAAGCGACGTAAGGCAGTTCGGTGCTGACACGATCAGTAAAGCCTTTACGCTCGACTTCGTGCA
TTACCGCGATCAGATGACCGCCGTCTCCCCTGATTTCTCAGAGGAAGGCTTTGCCGGTTATAACCAGGCG
CTGACGACTGGCTCTAACATCCTGTCGCTCGTCAAAGACAAGCGTATGAACCTCACCAATACCGTTGAGC
CGGGTGTAATAGCGCGCCGGGGTGTGATTGGCGACCGGTACACCTGGGAGTTCCAGTACCCGGTTACGAT
GCGCCTGCAGGGACAGAACAGCAGCAGCCCGCCGCTGCGCTACATATTTACGCTGCGCATTCAGCAGGCC
GATGTGCGACGGAAGCCGCGCGGTCTGGAGGTCACGCAGACTATCACCAACAATGCAGGTTAA
 Primer design