SecReT4
Protein ID: 293386488
T4SS name [ID]Tra_I [175]
Gene symboltraN
Locus tagEAM_P269
StrainErwinia amylovora ATCC 49946
Repliconplasmid 2 [GenBank: NC_013973] [Browse all T4SS(s) in this replicon]
Location [Strand]51638..52555 [+]
Productconjugal transfer protein
Component typeTraN_I
UniProt IDD4IGV5
KEGG IDeay:EAM_P269
PDB IDNA
Domain hit(s) vs Pfam DUF3625 [PF12293], Evalue: 2.6e-79, Aligned region: 58..303
Protein Sequence: 305 a.a.     [Download]
>gi|293386488|ref|YP_003540650.1| conjugal transfer protein [Erwinia amylovora ATCC 49946]
MSNIRTLVLALCLGLCGSAGAATTGETPAGNTAGPLPGQALPPPTSAAYDEAQASLSPLSADEIRQLRAQ
QAEQDRAIATPGITAVPRITAQTLSLQPGASLPLVRTAVNWPATVSFIDSTGAPWVLLGAPHSGSPDINV
EWMPGTSFMIITAKRDFVSTLVTVGLKGLSVPLQISVMSGEPDTAKKTWTVDARLDLRVPRRGPDAVADA
PSPSRIGLHDDVLQAFLDGVPPSGAKRLKTMGSVPDTVVWQQGDDLYIRSRADIRDEFDTTLSSADGTHL
WKLPLTPRVAFSVDGRTEALSIALE
 
Nucleotide Sequence: 918 bp     [Download]
>ref|NC_013973.1|:51638-52555 conjugal transfer protein [Erwinia amylovora ATCC 49946]
ATGAGCAACATTCGCACTCTGGTACTGGCTCTGTGTCTGGGGCTGTGCGGCAGCGCGGGCGCTGCGACAA
CGGGTGAGACTCCGGCCGGCAACACGGCGGGACCTCTGCCCGGGCAGGCGCTCCCGCCGCCAACGTCCGC
CGCATATGATGAGGCACAGGCATCGTTGTCACCACTCTCGGCGGATGAAATCCGGCAGTTACGCGCACAG
CAGGCTGAACAGGATCGGGCAATAGCCACGCCGGGCATCACGGCCGTACCGCGTATCACAGCACAGACCT
TAAGCCTGCAGCCGGGTGCGAGCCTCCCTCTGGTGCGTACAGCCGTAAACTGGCCCGCGACGGTCAGTTT
TATCGACAGCACCGGTGCTCCCTGGGTCCTGCTCGGTGCCCCGCACAGCGGGTCCCCGGATATCAATGTG
GAATGGATGCCCGGAACCTCTTTCATGATTATCACGGCAAAGCGCGACTTCGTGAGCACGCTCGTTACCG
TGGGTCTGAAGGGGCTTTCCGTTCCGCTGCAGATAAGCGTGATGAGTGGTGAACCAGACACAGCAAAAAA
GACCTGGACGGTTGATGCGCGGCTTGACCTGCGCGTGCCCCGTCGCGGGCCAGACGCTGTGGCCGATGCG
CCATCGCCTTCACGAATCGGGCTTCACGATGACGTACTGCAGGCGTTTCTGGACGGCGTGCCACCGTCCG
GTGCAAAGCGTCTGAAGACCATGGGCAGCGTGCCTGACACAGTGGTATGGCAGCAGGGCGATGACCTGTA
TATCCGCTCGCGAGCAGATATCCGGGACGAGTTCGATACCACGCTGTCCTCTGCTGATGGCACTCATCTG
TGGAAGCTGCCGCTGACGCCACGCGTCGCATTTTCCGTTGACGGGCGTACCGAGGCCCTCAGCATTGCCC
TGGAGTAA
 Primer design