SecReT4
Protein ID: 293386489
T4SS name [ID]Tra_I [175]
Gene symboltraO
Locus tagEAM_P270
StrainErwinia amylovora ATCC 49946
Repliconplasmid 2 [GenBank: NC_013973] [Browse all T4SS(s) in this replicon]
Location [Strand]52558..53877 [+]
Productconjugal transfer protein
Component typeTraO_I
UniProt IDD4IGV6
KEGG IDeay:EAM_P270
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 439 a.a.     [Download]
>gi|293386489|ref|YP_003540651.1| conjugal transfer protein [Erwinia amylovora ATCC 49946]
MSDQQNTGGRSIRLMIGLIALGAGVLTGGGYLLWTWLAAPPPAPSSIDMNNLGAMAQNNAQEQQAYRDLI
RENNARGAHNASANNQTFLGSIPLEQDVIKPVEVKAKPPQDKPKDILPPQTRGSGRTQEQEKALAEARQK
ALAALLAKMQQPPETEELPEAKLLGGKDSSWAAWRDSLPGSEVQLAAARSRQNTLNAPPASVVVEPYWRG
PGEICTGVDSDNGATPVLGCIKTGPYAGAVLKAPEGAKLSGNGVIIHFTTMTLNSKAYKIDAYGLDDKTL
VANIASDVDHHYGRRILLPAFLKGIGATGELYAQSNTQVLTNGFNTVTARPSAPDGSAVAGVIVGGAAEQ
AAQVLTNDAGRLADRTVTVDYGKVVAIQFMSGVYSTDAEAPQDTTSGNTGAAAPAGWRNNPTPTAAYLRD
EAQARIRDARQRKTGDALE
 
Nucleotide Sequence: 1320 bp     [Download]
>ref|NC_013973.1|:52558-53877 conjugal transfer protein [Erwinia amylovora ATCC 49946]
ATGAGCGATCAACAAAATACCGGCGGGCGTAGTATCCGCCTGATGATAGGGCTAATAGCGCTTGGCGCAG
GCGTGCTGACAGGAGGTGGTTATCTGTTATGGACATGGCTTGCTGCGCCACCGCCCGCGCCATCCAGCAT
AGACATGAACAACCTCGGCGCCATGGCGCAAAATAATGCGCAGGAGCAGCAGGCCTATCGAGATCTTATC
CGTGAAAACAATGCGCGGGGAGCGCATAACGCATCGGCGAACAATCAGACTTTCCTTGGCAGCATTCCGC
TGGAGCAGGACGTCATTAAACCTGTGGAAGTGAAGGCTAAGCCACCTCAGGACAAGCCAAAGGATATTCT
GCCACCGCAAACCAGAGGCAGCGGCCGCACGCAGGAGCAGGAGAAGGCGCTGGCAGAAGCCCGACAGAAG
GCGCTGGCCGCACTGCTGGCAAAGATGCAACAGCCTCCAGAAACGGAAGAGCTGCCTGAGGCGAAGTTGC
TTGGTGGAAAGGACAGCAGCTGGGCTGCCTGGCGCGATTCGCTGCCCGGCAGTGAAGTTCAGCTGGCCGC
CGCGCGCAGCCGGCAGAACACGCTGAATGCTCCGCCGGCATCTGTAGTAGTGGAACCGTACTGGCGAGGG
CCCGGGGAAATCTGTACGGGTGTTGACTCAGATAACGGCGCCACGCCGGTGCTGGGCTGCATCAAAACGG
GGCCTTATGCAGGGGCGGTGCTGAAGGCGCCTGAGGGAGCGAAGCTCTCAGGCAACGGCGTCATTATTCA
CTTCACCACCATGACCCTGAACAGTAAGGCCTACAAAATCGATGCTTACGGGCTGGACGACAAGACGCTC
GTGGCAAACATCGCATCTGACGTCGATCATCATTACGGTCGTCGTATTCTGCTGCCCGCATTCCTCAAGG
GAATCGGCGCGACCGGCGAGCTCTATGCGCAGTCGAATACGCAGGTGCTGACTAATGGATTCAACACCGT
TACCGCGCGGCCGTCCGCGCCGGATGGCTCGGCGGTGGCAGGCGTTATTGTTGGTGGTGCGGCAGAGCAG
GCCGCGCAAGTGCTGACGAATGATGCGGGCCGTCTGGCGGACAGGACGGTTACAGTTGACTACGGCAAGG
TAGTAGCCATTCAGTTCATGAGCGGCGTGTACAGCACCGATGCTGAAGCGCCGCAGGACACAACATCAGG
TAACACTGGCGCAGCAGCTCCGGCTGGCTGGCGCAACAATCCAACCCCTACCGCAGCCTATCTGCGAGAC
GAAGCGCAGGCGCGCATTCGCGACGCCCGACAGAGAAAAACAGGAGACGCCCTTGAATGA
 Primer design