SecReT4
Protein ID: 293386490
T4SS name [ID]Tra_I [175]
Gene symboltraP
Locus tagEAM_P271
StrainErwinia amylovora ATCC 49946
Repliconplasmid 2 [GenBank: NC_013973] [Browse all T4SS(s) in this replicon]
Location [Strand]53870..54649 [+]
Productconjugal transfer protein
Component typeTraP_I
UniProt IDD4IGV7
KEGG IDeay:EAM_P271
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 259 a.a.     [Download]
>gi|293386490|ref|YP_003540652.1| conjugal transfer protein [Erwinia amylovora ATCC 49946]
MNEFQTLPADNASPTPPPPQSPPPPKKESLLTRPLFLGQSLPWLAGGALIILGAVLYLYWPASSTPDAGQ
LAFGNEDGFSEVKPASVTPQPSAVSQRPVTAPQTGGLSVPVDAIGNPSAGGALPEEVEKIIREGQEFEAA
NREAITRLSDTVRAQSAALASMQQRIDSIASENSRLAGQLTVMNARQDPVAGGHSAAGNKIRRSALSGMR
LESVQDGMAWVSWQGRTWAVQSGDSLGGITVRDISTADRSVTTSAGVLR
 
Nucleotide Sequence: 780 bp     [Download]
>ref|NC_013973.1|:53870-54649 conjugal transfer protein [Erwinia amylovora ATCC 49946]
TTGAATGAGTTCCAGACATTACCGGCGGATAACGCCTCACCGACCCCGCCGCCTCCACAGTCTCCTCCGC
CACCGAAAAAAGAGAGCCTTCTGACGCGACCTTTATTTCTCGGGCAGTCGCTGCCGTGGCTTGCCGGCGG
CGCTCTGATAATTCTTGGAGCGGTCTTGTATCTGTACTGGCCAGCATCATCTACGCCCGACGCCGGGCAG
CTGGCATTCGGAAACGAAGACGGATTCAGCGAGGTAAAGCCGGCTTCCGTTACGCCTCAGCCCAGCGCTG
TATCTCAGAGGCCTGTAACAGCGCCACAAACCGGAGGGCTCAGCGTTCCCGTTGACGCTATCGGCAATCC
TTCGGCTGGCGGCGCACTGCCGGAAGAAGTGGAGAAAATTATCCGTGAAGGGCAGGAATTTGAAGCGGCA
AATCGCGAGGCCATTACCCGGCTCTCTGATACGGTGCGAGCGCAAAGTGCAGCACTGGCAAGCATGCAGC
AGCGGATTGATTCGATTGCGTCCGAGAACAGCCGGCTGGCAGGTCAGCTTACAGTAATGAATGCGCGTCA
GGATCCGGTAGCCGGCGGCCACAGCGCGGCAGGCAATAAAATCCGTCGCTCAGCACTTTCGGGCATGCGG
CTTGAAAGCGTTCAGGATGGTATGGCGTGGGTCAGCTGGCAGGGGCGGACATGGGCGGTGCAGTCCGGGG
ACAGCCTGGGAGGCATCACCGTCCGCGACATAAGTACCGCTGACCGCAGCGTTACGACCAGTGCGGGCGT
GCTGCGCTAA
 Primer design