SecReT4
Protein ID: 293386491
T4SS name [ID]Tra_I [175]
Gene symboltraQ
Locus tagEAM_P272
StrainErwinia amylovora ATCC 49946
Repliconplasmid 2 [GenBank: NC_013973] [Browse all T4SS(s) in this replicon]
Location [Strand]54659..55198 [+]
Productconjugal transfer protein
Component typeTraQ_I
UniProt IDD4IGV8
KEGG IDeay:EAM_P272
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 179 a.a.     [Download]
>gi|293386491|ref|YP_003540653.1| conjugal transfer protein [Erwinia amylovora ATCC 49946]
MSGSLDGITMLSNLASGLLVAGINLALTLGVLFAVLGLSGYLARQSWLARKAPGQAASGGSVVGMILLCA
ALGAIQQLIQAAAHQVGWEASFDAISYVDVGTFGQGAVAANAILTLLRMFGVWFVLSGVQLWRRAKKDGH
TGLTSGNDVNSGTVKFIVGVCFVCSPYLLDAIQKSIGMR
 
Nucleotide Sequence: 540 bp     [Download]
>ref|NC_013973.1|:54659-55198 conjugal transfer protein [Erwinia amylovora ATCC 49946]
ATGAGTGGTTCACTCGACGGAATCACGATGCTGTCGAATCTCGCCTCTGGTCTGCTAGTTGCGGGTATTA
ACCTCGCGCTGACGCTCGGCGTATTGTTCGCTGTACTCGGCCTTAGCGGCTATCTCGCCCGGCAGTCCTG
GCTTGCCCGTAAGGCACCCGGTCAGGCGGCAAGTGGCGGCAGCGTAGTGGGGATGATTCTGCTGTGCGCT
GCCCTGGGCGCTATTCAGCAGCTGATTCAGGCTGCAGCTCATCAGGTGGGCTGGGAAGCGTCGTTTGATG
CCATCAGCTACGTAGACGTCGGCACCTTTGGACAAGGGGCGGTTGCGGCCAACGCAATACTGACGCTGCT
GCGCATGTTCGGCGTGTGGTTCGTTCTCTCAGGCGTCCAGCTGTGGCGCCGGGCAAAAAAGGACGGCCAT
ACCGGCCTGACTTCTGGCAACGACGTTAACAGCGGCACCGTTAAATTTATCGTCGGCGTGTGTTTTGTGT
GCAGTCCCTATCTGCTCGACGCCATTCAAAAATCAATTGGCATGCGTTAA
 Primer design