SecReT4
Protein ID: 293386492
T4SS name [ID]Tra_I [175]
Gene symboltraR
Locus tagEAM_P273
StrainErwinia amylovora ATCC 49946
Repliconplasmid 2 [GenBank: NC_013973] [Browse all T4SS(s) in this replicon]
Location [Strand]55270..55656 [+]
Productconjugal transfer protein
Component typeTraR_I
UniProt IDD4IGV9
KEGG IDeay:EAM_P273
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 128 a.a.     [Download]
>gi|293386492|ref|YP_003540654.1| conjugal transfer protein [Erwinia amylovora ATCC 49946]
MMNRITCAVFSRALMLSETLRRAFLRALFAWVAFISPGAMAAGDLADIGNNLATGASSTTKNVLTICTLL
GVCGVVGSIFALKSMKNNPQIKPWMVGVGFVTGLLLIVIPELIKRGQTQMGMTPVSVG
 
Nucleotide Sequence: 387 bp     [Download]
>ref|NC_013973.1|:55270-55656 conjugal transfer protein [Erwinia amylovora ATCC 49946]
ATGATGAACCGTATCACCTGCGCGGTGTTTTCGCGCGCCCTTATGCTGTCTGAAACTCTGCGTCGCGCTT
TTCTGCGTGCGCTTTTTGCTTGGGTCGCATTCATTTCACCGGGGGCCATGGCCGCCGGCGATCTCGCGGA
TATCGGCAATAACCTTGCTACCGGCGCCTCTTCCACTACAAAAAACGTGCTCACTATCTGCACTTTGCTG
GGCGTGTGTGGCGTGGTCGGGAGTATTTTTGCGCTTAAGTCTATGAAAAATAATCCTCAGATTAAGCCCT
GGATGGTCGGAGTTGGTTTTGTCACCGGCCTGCTGCTGATCGTTATTCCTGAGCTGATTAAGCGTGGTCA
GACCCAGATGGGTATGACACCTGTCAGCGTTGGCTAA
 Primer design