SecReT4
Protein ID: 293386493
T4SS name [ID]Tra_I [175]
Gene symboltraT
Locus tagEAM_P274
StrainErwinia amylovora ATCC 49946
Repliconplasmid 2 [GenBank: NC_013973] [Browse all T4SS(s) in this replicon]
Location [Strand]55761..56375 [+]
Productconjugal transfer protein
Component typeTraT_I
UniProt IDD4IGW0
KEGG IDeay:EAM_P274
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 204 a.a.     [Download]
>gi|293386493|ref|YP_003540655.1| conjugal transfer protein [Erwinia amylovora ATCC 49946]
MTVLNVPAPDLLQLVPGISGYDVAPPPVPVDAGPACCGCGTRAQRLWQGPDAVPLCTLCWLTLNMDSPTA
AHGHLAWLPDAPAADIINLQRRALIGLHSKVKSVRKESRKIWNWLARHAREVEGMWHTSRAGEFAVAMKQ
LPPARRAQMQQRLEGCLLILPPDVFSDLTLLLPLGRTAESAVNTPAWNTYIWSDLYAKPPHPLD
 
Nucleotide Sequence: 615 bp     [Download]
>ref|NC_013973.1|:55761-56375 conjugal transfer protein [Erwinia amylovora ATCC 49946]
ATGACCGTTCTTAACGTGCCGGCACCGGATCTGCTGCAGCTTGTGCCGGGCATCAGCGGATATGATGTCG
CTCCTCCGCCCGTGCCGGTTGACGCAGGTCCAGCCTGCTGCGGCTGCGGTACACGAGCGCAGCGCCTCTG
GCAGGGGCCTGACGCCGTGCCGCTATGTACGCTCTGCTGGCTGACCCTCAACATGGACAGCCCCACGGCT
GCACACGGACACCTTGCCTGGCTGCCAGATGCGCCGGCAGCAGACATCATCAATCTGCAGCGACGCGCGC
TTATCGGGCTGCACAGTAAGGTCAAAAGCGTGCGAAAGGAGTCACGGAAAATCTGGAACTGGCTCGCCCG
GCACGCCCGGGAAGTTGAAGGCATGTGGCACACCTCACGCGCTGGGGAGTTTGCCGTTGCCATGAAGCAG
CTCCCGCCAGCCCGGCGGGCGCAGATGCAGCAGAGGCTTGAAGGCTGTTTATTGATCCTTCCCCCTGACG
TTTTCAGTGACCTTACCTTGCTATTGCCGCTGGGACGAACCGCAGAAAGCGCGGTTAATACCCCGGCATG
GAATACCTATATCTGGAGCGACCTGTATGCCAAACCGCCTCATCCGCTGGACTGA
 Primer design