SecReT4
Protein ID: 293386494
T4SS name [ID]Tra_I [175]
Gene symboltraU
Locus tagEAM_P275
StrainErwinia amylovora ATCC 49946
Repliconplasmid 2 [GenBank: NC_013973] [Browse all T4SS(s) in this replicon]
Location [Strand]56347..59400 [+]
Productconjugal transfer protein
Component typeTraU_I
UniProt IDD4IGW1
KEGG IDeay:EAM_P275
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 4.1e-45, Aligned region: 498..897
Protein Sequence: 1017 a.a.     [Download]
>gi|293386494|ref|YP_003540656.1| conjugal transfer protein [Erwinia amylovora ATCC 49946]
MPNRLIRWTEEVITAVTRFAVSRDLPDYCDLETVIKLTDDDRVRHPELSAPYIMVTNGGDFLTVYEVAGS
YRETDEAKGPDNVDSWQGRLDRMTETLTALYRHHGHKISTIHECDPDGGEAEVKRLLAPQYRSLKRTGLD
LAYLLDEQVTTLAPWVNRERTWLVCYTGRGVLAGHELRDENARLKELINASPPAAFGQNPLTAHLPGLKI
RHDAFLSQVERALGDTGKGVLLIRMDAHEAGRVLRTQIDPKGTGDRWQPLLPDDRVIPHGVRQGEDVTAL
LAPWLKFQVMNSSVQEIRDNLLKIHGIWHGTIAVDLGPQNPQSFARLRELIPRSVPFRIRQDLMPGGMRR
LGGKHAVLGFTEWVPGLKAISESVNLLAERERIEPVCVKTITVATWGDTPEDVTRNLTLLSQALTSWGVC
GVTQTFGDPVRAWVSTLTASSASPGPCLMYPPLSEALNLMPLTRPASPWNEDGDALYPTPDGKIIPVGLA
SPKQTKLTTIVAGESGGGKSVLINRMTLILASRAQQQLPFYCGIDKGFSSEGAVSMLKDGLPPERQDEVL
NIILRNESQYCRNLFDIQLGLTMPLSYEAEFMENALSVLCTDPSTGSPPNARDTPVILRRLITEAFKIAR
DDPRRYEPGMVPEVDLAIEEADIWEKHPAYREHCTWYEVRDLLQDAGRTEAAQRAQFQAVPELADMAPLL
SSPDFESNFGRVQRDGSGEALIEYMARCLRDACGQYRMFAGRTRFMISPKARVITVDLQYVAGGKSKAGQ
LQTGLMFLFAGHIAGGDFVLPQYQDELFPSLHLRWHALHRARVEQLDQEVKTKQYEELHNAKDVPFIYPM
LETADREQRKFAVRTVLSSQYFRDMPEALRQSANSVYMVAVDPDDRAALQARFQIPDVTLDRFARMGSGP
SADGSGVPFLGIFRVKGGSTIAHIMKNTVGPQELWGHNTTPEDMSLRRNIQKEVGAGTARRILGRFFPGG
SAAKVIEHRRRMAGEAQGESVIKTLANELISKQGYNL
 
Nucleotide Sequence: 3054 bp     [Download]
>ref|NC_013973.1|:56347-59400 conjugal transfer protein [Erwinia amylovora ATCC 49946]
ATGCCAAACCGCCTCATCCGCTGGACTGAAGAGGTTATTACCGCCGTAACGCGTTTTGCCGTTTCGCGCG
ATTTGCCTGATTACTGCGACCTTGAAACCGTCATAAAACTTACGGACGACGATCGCGTTCGTCATCCGGA
ACTGAGCGCACCCTACATCATGGTAACGAATGGCGGAGACTTCCTGACCGTCTATGAGGTGGCCGGCAGC
TATCGCGAAACCGACGAAGCCAAAGGCCCAGACAATGTTGACTCTTGGCAGGGTCGGCTGGATCGCATGA
CCGAAACCCTCACAGCTCTTTACCGTCATCACGGACATAAAATCAGCACGATTCATGAGTGCGATCCTGA
TGGGGGGGAGGCTGAAGTAAAGCGCCTGCTGGCGCCGCAGTACCGTTCGCTGAAGCGTACCGGGCTGGAC
CTGGCTTATTTGCTGGATGAACAGGTGACCACGCTCGCGCCCTGGGTAAACCGTGAGCGCACCTGGCTTG
TCTGCTATACCGGGCGTGGCGTTCTGGCAGGGCACGAGCTGCGCGATGAGAATGCCCGTCTTAAAGAGCT
TATTAATGCGAGCCCGCCCGCGGCGTTCGGCCAGAATCCGCTCACTGCACATCTGCCCGGTCTGAAGATA
CGTCACGATGCCTTTCTTTCGCAGGTTGAGCGGGCGCTCGGAGATACTGGCAAGGGCGTTCTGCTGATAC
GTATGGATGCGCATGAGGCGGGGCGGGTGTTGCGCACACAAATCGATCCCAAAGGTACGGGCGACCGCTG
GCAACCACTGCTGCCGGATGACCGCGTAATACCTCACGGCGTGCGTCAGGGTGAAGACGTGACCGCGCTG
CTGGCACCCTGGCTTAAATTTCAGGTAATGAATTCCAGCGTCCAGGAGATTCGCGACAATCTGCTTAAGA
TTCACGGCATCTGGCACGGGACGATTGCCGTTGACCTTGGACCGCAGAATCCCCAGAGCTTTGCCCGATT
ACGCGAGCTTATCCCCCGCAGCGTGCCATTTCGTATCCGCCAGGACCTGATGCCTGGTGGCATGCGCCGC
CTGGGAGGAAAGCATGCTGTGCTGGGCTTTACAGAATGGGTGCCCGGCCTGAAGGCCATCAGTGAATCGG
TAAATCTCCTCGCGGAGCGTGAGCGCATTGAACCTGTGTGCGTGAAAACTATTACCGTGGCCACATGGGG
CGACACGCCAGAAGATGTCACGCGCAACCTGACGCTGCTCAGTCAGGCACTGACCTCATGGGGAGTTTGT
GGCGTTACACAGACATTCGGCGATCCGGTGCGAGCATGGGTATCCACGCTTACCGCGTCATCGGCCTCGC
CCGGACCCTGCCTGATGTATCCGCCCCTTTCAGAAGCGCTAAACCTGATGCCACTGACGCGACCTGCTTC
GCCATGGAATGAAGACGGGGATGCGCTCTATCCCACACCGGACGGAAAAATCATCCCGGTGGGCCTGGCA
TCGCCAAAACAGACCAAGCTCACTACCATCGTGGCCGGTGAGTCGGGTGGCGGTAAGTCCGTACTTATCA
ACAGAATGACACTAATCCTGGCCAGCCGTGCTCAGCAGCAGCTGCCGTTTTATTGCGGTATTGACAAGGG
ATTCAGTTCTGAAGGTGCTGTCTCGATGCTTAAGGACGGGCTGCCGCCGGAGCGACAGGATGAAGTGCTG
AATATCATTCTGCGCAATGAGTCGCAGTATTGCCGCAACCTGTTTGATATCCAGCTGGGCCTTACGATGC
CGCTGAGTTACGAAGCCGAATTCATGGAAAACGCGCTTAGCGTTCTGTGTACTGACCCCTCTACCGGCTC
TCCACCTAATGCCCGCGATACGCCCGTTATTCTTCGTCGTCTCATCACTGAAGCATTCAAAATAGCGCGT
GATGATCCGCGTCGCTATGAGCCAGGAATGGTGCCTGAAGTGGATCTAGCAATTGAAGAAGCTGATATCT
GGGAAAAACACCCTGCCTATCGCGAACACTGCACCTGGTATGAAGTACGCGATCTTCTGCAGGATGCGGG
CAGAACTGAAGCAGCACAGCGCGCGCAGTTTCAGGCAGTGCCGGAGCTTGCTGATATGGCTCCGCTGCTG
AGCAGCCCTGATTTTGAGAGTAACTTTGGCCGTGTCCAGCGCGACGGCAGCGGCGAGGCACTTATTGAGT
ACATGGCGCGCTGTCTTCGAGACGCCTGTGGCCAGTATCGGATGTTTGCGGGCCGCACGCGGTTCATGAT
TAGCCCGAAAGCGCGCGTCATAACGGTAGATCTGCAGTATGTAGCAGGCGGTAAATCCAAGGCCGGGCAG
CTGCAGACCGGCTTAATGTTCCTGTTTGCAGGGCACATTGCCGGCGGCGACTTCGTGCTGCCGCAGTACC
AGGATGAACTGTTTCCTTCTTTGCACCTCCGCTGGCATGCGCTACACCGCGCTCGCGTGGAACAGCTGGA
TCAGGAAGTGAAAACGAAGCAGTACGAAGAGCTCCATAACGCTAAAGACGTACCGTTTATTTACCCGATG
CTCGAAACCGCAGACCGCGAACAGCGAAAGTTTGCAGTGCGTACCGTGCTGTCATCGCAGTATTTCCGCG
ATATGCCGGAGGCGCTGCGCCAGTCCGCCAACTCCGTTTATATGGTGGCGGTTGACCCTGACGACCGCGC
GGCGCTGCAGGCGCGCTTCCAGATCCCTGACGTAACGCTCGATCGCTTCGCTCGCATGGGCAGCGGGCCA
TCAGCAGATGGCAGTGGCGTACCGTTCCTCGGTATTTTCCGCGTGAAGGGTGGCAGCACTATTGCGCACA
TCATGAAGAATACCGTCGGTCCGCAGGAACTGTGGGGCCACAACACCACACCTGAAGATATGTCGCTGCG
ACGCAATATTCAGAAGGAAGTGGGCGCCGGGACGGCCCGCCGTATTCTTGGCCGATTCTTTCCGGGAGGT
TCCGCAGCTAAGGTCATCGAGCACCGCCGACGCATGGCAGGGGAAGCGCAGGGCGAAAGCGTTATTAAGA
CGCTGGCAAATGAGCTTATCAGCAAACAGGGCTACAACCTCTGA
 Primer design