SecReT4
Protein ID: 293386495
T4SS name [ID]Tra_I [175]
Gene symboltraW
Locus tagEAM_P276
StrainErwinia amylovora ATCC 49946
Repliconplasmid 2 [GenBank: NC_013973] [Browse all T4SS(s) in this replicon]
Location [Strand]59414..60634 [+]
Productconjugal transfer protein
Component typeTraW_I
UniProt IDD4IGW2
KEGG IDeay:EAM_P276
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 406 a.a.     [Download]
>gi|293386495|ref|YP_003540657.1| conjugal transfer protein [Erwinia amylovora ATCC 49946]
MKTHNRWPASRRLLAACILAAIAPHAMAYPTEEMSSVPITQQVMPSLKLMQTTLGEILSADTETGTAVVQ
SGDKITTAITESARTQREAENFNRQADRLEKARTAYTVPDSICTESASGSAAQVNQATRATASKLSGGGG
VSNKVVRETLASLPVAPRQGGYRSALLHAAYCTKEEAALYGGTGLCPSVSSLPGGDTEARSLYDGAGQPG
KDPELTFTQAQTDAAMAYVNNSAKLDAGRTPGKGEIQTATGQEYQGLLTQYKAMQSAAMQPQLDMVAASQ
PQDATREALTEARQAPSAETYFQQTASAQAKQTGTMSEREFEAFEVGRRYANTEWVKDLQSMEGDNLLRE
MARQQSLANWLAMGIKNELRQANIISGQQLALAAKEQYAPQLQALSAQLSAGVSAH
 
Nucleotide Sequence: 1221 bp     [Download]
>ref|NC_013973.1|:59414-60634 conjugal transfer protein [Erwinia amylovora ATCC 49946]
ATGAAAACACATAACCGGTGGCCGGCAAGCCGCAGGTTGCTGGCTGCCTGCATACTGGCAGCCATAGCGC
CGCACGCGATGGCTTACCCAACGGAAGAAATGAGCAGCGTCCCCATAACTCAACAGGTGATGCCATCGCT
GAAGTTGATGCAGACCACGCTTGGCGAAATCCTGTCGGCTGATACCGAGACCGGCACGGCTGTAGTGCAG
TCCGGTGACAAAATCACTACGGCTATCACAGAGTCAGCACGAACGCAGCGTGAGGCAGAAAACTTTAATC
GCCAAGCTGACCGGCTGGAAAAGGCCCGCACTGCCTACACCGTACCAGACAGCATCTGCACTGAGTCAGC
GTCAGGATCGGCGGCGCAGGTAAATCAGGCTACCCGGGCAACGGCATCAAAGCTCTCAGGCGGGGGCGGG
GTATCAAACAAGGTTGTTCGTGAGACGCTCGCAAGCCTCCCCGTCGCGCCGCGACAGGGCGGCTACCGCA
GCGCGCTGTTACATGCTGCGTACTGCACGAAGGAGGAGGCCGCACTGTATGGTGGTACCGGCCTTTGCCC
GAGCGTCTCCTCGCTGCCGGGCGGGGATACCGAGGCGCGATCGCTGTATGACGGTGCCGGGCAGCCTGGT
AAGGATCCGGAACTGACATTTACGCAGGCGCAGACAGATGCGGCAATGGCCTATGTAAACAACTCGGCGA
AGCTCGATGCCGGGCGTACGCCTGGCAAAGGCGAAATCCAGACCGCGACCGGGCAGGAGTATCAGGGTCT
GCTCACTCAGTATAAGGCGATGCAAAGTGCTGCGATGCAGCCCCAGCTGGACATGGTAGCAGCGAGTCAG
CCACAGGATGCAACGCGCGAGGCGCTGACCGAAGCCCGGCAGGCGCCGTCCGCAGAAACCTATTTCCAGC
AGACCGCCTCCGCGCAGGCAAAGCAGACCGGCACCATGAGCGAGCGTGAATTTGAGGCGTTTGAAGTGGG
GCGCCGTTATGCCAATACGGAGTGGGTAAAGGACCTGCAGAGCATGGAAGGTGACAACCTGCTGCGTGAA
ATGGCACGTCAGCAAAGTCTCGCCAACTGGCTGGCCATGGGTATCAAGAACGAATTGCGTCAGGCAAACA
TCATCAGCGGCCAGCAGCTGGCGCTTGCTGCAAAAGAGCAGTACGCACCACAGCTGCAGGCACTGTCAGC
CCAGCTCAGCGCCGGCGTAAGCGCGCATTAA
 Primer design