SecReT4
Protein ID: 293386497
T4SS name [ID]Tra_I [175]
Gene symboltraX
Locus tagEAM_P278
StrainErwinia amylovora ATCC 49946
Repliconplasmid 2 [GenBank: NC_013973] [Browse all T4SS(s) in this replicon]
Location [Strand]61398..61988 [+]
Productconjugal transfer protein
Component typeTraX_I
UniProt IDD4IGW4
KEGG IDeay:EAM_P278
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 196 a.a.     [Download]
>gi|293386497|ref|YP_003540659.1| conjugal transfer protein [Erwinia amylovora ATCC 49946]
MKRADTEAPATNEKKATITPKRLGWFVMNVFVPAAEITGVVRYTGRSVSRIWQRIRDVTAGRNAHGYCPA
DWSQAVSDSGLSPARLARNFRITRWLWWGLMWLTGLPALGCLALLIAAGGNVSGTGWLRIGCVLLVMSLL
TATGFVQVLVASYRLWQLTEKRVSASEEGSFQAFLHETHWCRTVLSSGLVNRKKIA
 
Nucleotide Sequence: 591 bp     [Download]
>ref|NC_013973.1|:61398-61988 conjugal transfer protein [Erwinia amylovora ATCC 49946]
ATGAAAAGAGCTGATACTGAAGCTCCGGCAACTAATGAGAAGAAGGCCACAATCACGCCGAAGCGCTTAG
GCTGGTTTGTTATGAATGTGTTCGTGCCGGCCGCTGAAATTACTGGCGTGGTTCGCTATACAGGGCGTAG
CGTCTCGCGAATCTGGCAGCGCATCCGGGATGTTACCGCCGGCCGCAATGCACATGGCTACTGCCCAGCT
GACTGGTCACAAGCGGTTTCTGACAGCGGGCTTAGCCCGGCACGTCTGGCACGCAATTTTCGCATTACTC
GCTGGCTGTGGTGGGGGCTGATGTGGCTCACCGGGCTGCCGGCGCTGGGATGTCTGGCGCTGTTGATCGC
AGCAGGTGGTAACGTCAGCGGCACCGGCTGGCTGCGCATAGGCTGTGTGCTGCTTGTCATGAGTCTGCTG
ACAGCTACCGGTTTCGTTCAGGTGCTGGTAGCAAGCTACAGGCTCTGGCAGCTCACGGAAAAAAGGGTCT
CGGCGTCAGAAGAAGGCAGTTTTCAGGCATTTCTGCATGAGACGCACTGGTGTCGTACGGTTTTAAGCAG
TGGCTTAGTGAACAGGAAAAAAATTGCGTGA
 Primer design