SecReT4
Protein ID: 293386500
T4SS name [ID]Tra_I [175]
Gene symboltraY
Locus tagEAM_P281
StrainErwinia amylovora ATCC 49946
Repliconplasmid 2 [GenBank: NC_013973] [Browse all T4SS(s) in this replicon]
Location [Strand]62918..65053 [+]
Productconjugal transfer protein
Component typeTraY_I
UniProt IDD4IGW7
KEGG IDeay:EAM_P281
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 711 a.a.     [Download]
>gi|293386500|ref|YP_003540662.1| conjugal transfer protein [Erwinia amylovora ATCC 49946]
MKLLKKIQAAVLLYAASCPALADGVNYQTISDAAQKTGDLSRQALVMIFGDVVITPFQPGQPTLIGSLFA
LLNGVLCSVALAWFLIVTLKTLFKGGQDGKVFSAGRSVLHPVMSFAGFITLIPTASGWSLSQLVMLWAAS
TMGIGSANLLTDKAADMISSGMSLVVQPTAPSTRSAARAVFEMNLCKYSTNRELSSLYQDGQARTALMTT
SGGNGNYTTGNGSAVCGSVRIPDPSKGITESLFGSQVNTDSVTAAERSALDTMQSTLDTAAQAYVDAYLS
RRDQDTGNMSDAETTIQKAAAAYETTVNNALNQLNYKDSLQAQLTSQLKNYGWMSLGAWYNTFATANSKT
NSVANAAPVTSGPSFHGETGTGDLYHQVFAAYRSQTQNSSYTPPLGTQSAADDSIAGSSSDPDAIFVGFL
KSPVQRLTTFFATDAKGNSSDFSNQVNPLIKMQAIGDYTLGATETALTAYVAAYGVAAAVDHSLVGKFGE
LTQNPAGTVKDILGMLSPPFYFLMLLLFAVGFSLAVFLPAIPFLYWMVGSFNWIVSVMVGCAAGPMWSAT
HLGAEEDKGSRSAYGYIFLIDMMLRPSLMVLGFFFASVAVMAGGTLLNLLFGTAVANSNADSIMGVVKLV
GWLMMYARIATFGVSRVFGLLATLADYVITFLGGAGMAGIMGGMVDDVKGMFASAGSGSRRTPGLKSMPN
RQAPASEDGIK
 
Nucleotide Sequence: 2136 bp     [Download]
>ref|NC_013973.1|:62918-65053 conjugal transfer protein [Erwinia amylovora ATCC 49946]
ATGAAGCTACTGAAAAAAATTCAGGCGGCGGTATTGCTGTACGCCGCGTCCTGCCCGGCTCTCGCCGACG
GCGTAAATTATCAGACCATCAGTGATGCGGCGCAGAAGACCGGAGATTTATCGCGGCAGGCGCTGGTGAT
GATCTTCGGCGACGTCGTCATCACACCTTTTCAGCCAGGTCAGCCAACGCTTATCGGCTCATTGTTTGCT
CTCCTGAATGGTGTACTGTGCTCAGTGGCGCTGGCATGGTTTCTGATAGTAACCCTGAAAACGCTGTTCA
AAGGGGGGCAGGACGGTAAAGTATTCAGTGCCGGCCGCTCTGTGCTACACCCGGTGATGAGCTTTGCCGG
CTTCATTACACTTATTCCTACCGCATCAGGCTGGTCACTCTCACAACTGGTGATGCTGTGGGCTGCTTCA
ACGATGGGCATCGGTAGTGCAAACCTGCTGACTGATAAAGCGGCCGATATGATCAGCAGCGGGATGTCGC
TCGTTGTGCAGCCCACCGCGCCCTCAACCCGATCAGCGGCGCGCGCAGTATTTGAAATGAACCTGTGCAA
ATATTCCACGAACAGGGAGCTTAGCTCGCTTTATCAGGATGGGCAGGCCAGAACAGCGCTGATGACGACG
TCAGGCGGTAACGGTAACTATACTACCGGCAATGGCAGCGCTGTTTGCGGCAGCGTTCGTATCCCTGACC
CCTCTAAAGGCATAACTGAAAGCCTATTTGGTTCACAAGTGAATACCGACAGCGTCACAGCCGCTGAACG
GAGCGCATTGGATACCATGCAGTCTACTCTGGACACTGCCGCACAGGCCTACGTAGACGCCTACCTGAGC
CGACGCGATCAGGACACAGGTAATATGTCCGATGCAGAAACAACTATCCAGAAAGCGGCGGCGGCTTACG
AAACAACGGTTAACAATGCGCTGAATCAGCTGAACTATAAAGATTCACTACAGGCCCAGCTTACCTCACA
GCTGAAAAACTACGGCTGGATGTCGCTGGGTGCGTGGTACAACACGTTTGCTACGGCAAACAGTAAAACC
AACTCGGTCGCTAATGCAGCACCTGTAACTTCAGGGCCCAGTTTTCATGGTGAGACAGGCACAGGTGATC
TTTATCATCAGGTTTTTGCAGCTTATCGTTCACAGACGCAGAACAGTTCGTATACCCCCCCATTAGGCAC
GCAAAGTGCCGCGGATGACAGCATTGCTGGCAGCTCATCCGATCCGGATGCAATCTTTGTAGGCTTCTTA
AAAAGTCCTGTCCAAAGGCTGACAACTTTCTTTGCAACAGATGCTAAAGGCAATAGTTCTGATTTTTCTA
ATCAGGTTAATCCGCTGATAAAAATGCAAGCCATTGGCGATTACACTTTAGGTGCAACTGAAACAGCGCT
TACTGCATATGTCGCTGCTTATGGGGTTGCTGCTGCAGTAGATCATTCTTTAGTAGGAAAATTCGGTGAA
TTAACACAAAACCCCGCAGGAACAGTAAAAGATATTTTAGGCATGCTATCGCCTCCATTTTATTTTTTAA
TGCTGCTGTTGTTTGCGGTCGGTTTTTCTCTGGCAGTCTTTCTTCCGGCAATACCTTTTCTTTACTGGAT
GGTTGGATCCTTTAATTGGATCGTCAGTGTTATGGTAGGTTGTGCAGCCGGACCAATGTGGTCCGCTACA
CATTTGGGCGCAGAAGAAGATAAAGGAAGCCGCAGCGCCTATGGTTATATTTTTCTGATTGATATGATGC
TCAGGCCTTCCCTTATGGTGTTAGGTTTCTTTTTTGCATCAGTAGCAGTCATGGCTGGCGGGACACTGCT
GAATTTATTATTTGGTACGGCAGTTGCCAACTCTAATGCTGATTCCATAATGGGGGTCGTTAAATTGGTT
GGATGGCTCATGATGTATGCGCGTATTGCCACTTTTGGCGTTTCTCGCGTATTCGGGTTACTGGCAACGC
TAGCAGACTATGTGATTACTTTCTTAGGTGGTGCAGGTATGGCAGGCATCATGGGCGGAATGGTAGACGA
TGTCAAAGGGATGTTTGCTTCCGCCGGCAGTGGTTCGCGTCGGACTCCTGGATTAAAAAGCATGCCTAAC
CGTCAGGCTCCAGCATCTGAAGATGGAATCAAATAA
 Primer design