SecReT4
Protein ID: 293386502
T4SS name [ID]Tra_I [175]
Gene symboltrbA
Locus tagEAM_P283
StrainErwinia amylovora ATCC 49946
Repliconplasmid 2 [GenBank: NC_013973] [Browse all T4SS(s) in this replicon]
Location [Strand]65897..67111 [+]
Productconjugal transfer protein
Component typeTrbA_I
UniProt IDD4IGW9
KEGG IDeay:EAM_P283
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 404 a.a.     [Download]
>gi|293386502|ref|YP_003540664.1| conjugal transfer protein [Erwinia amylovora ATCC 49946]
MYSQNPNAAGNNEQAAMAITLLITALLCWFFFSDFVRWSCWFLYWLWRLADFPQIHRYAAERINLLAATG
NGAEAVGLTEWMHVMNRTAGILFVPLIPLLTIAGWLLACHPGLGFRSRRAINIHSLPRVMLTFAPSVIPV
MASDQKDGLMNDTTPENAWALTPEEFAEQHGLIQRRVLDRDAARAVFDAQAGPEMTAPADWQPHERALLA
VFGLQVFTGDRKAATKLLDDLNRSCMTKRPFKAPIFRRTPDWRIAEIQLMRLLASPGINEWLNTHGTVRS
ALAGLYGRDLRLPPARFRWLKGCDRSLWYGLHTADTAKVFVEGSGIIAQARAEIKAAKMGLPRPALMTDE
AIAGLQLELEQLDLVYPRDQRQLPVKRKYQVTFPDSLYMPEQGDDELSDGAGAR
 
Nucleotide Sequence: 1215 bp     [Download]
>ref|NC_013973.1|:65897-67111 conjugal transfer protein [Erwinia amylovora ATCC 49946]
ATGTACTCTCAGAACCCGAACGCTGCCGGCAATAATGAGCAGGCGGCGATGGCGATCACCCTTTTAATCA
CGGCACTCCTGTGCTGGTTTTTCTTTAGTGACTTTGTCCGCTGGTCCTGCTGGTTTCTTTACTGGCTCTG
GCGCCTGGCAGACTTCCCGCAAATTCATCGCTATGCCGCCGAACGGATCAACCTGCTCGCTGCTACCGGA
AACGGCGCTGAGGCAGTGGGGCTGACAGAATGGATGCACGTCATGAACCGGACTGCCGGCATTCTTTTTG
TGCCACTGATCCCACTGCTTACCATAGCGGGCTGGCTGCTGGCATGCCATCCCGGGCTCGGTTTTCGCAG
CCGCAGGGCTATTAACATTCATTCACTACCTCGCGTGATGCTCACCTTTGCTCCCTCTGTAATACCGGTG
ATGGCCAGCGATCAGAAAGATGGGTTGATGAATGACACAACGCCGGAAAATGCATGGGCGCTCACACCTG
AGGAATTTGCCGAACAGCATGGGCTGATTCAGCGTCGGGTACTTGACCGTGACGCGGCCCGGGCTGTTTT
TGATGCGCAGGCTGGTCCGGAGATGACGGCACCGGCAGACTGGCAGCCGCACGAACGCGCGTTGCTCGCC
GTCTTCGGCCTACAGGTCTTCACCGGCGACCGTAAAGCGGCCACGAAGCTGCTCGATGACCTTAACCGCT
CCTGTATGACAAAACGTCCCTTCAAAGCACCCATTTTTCGCAGAACGCCAGACTGGCGCATCGCTGAGAT
CCAGCTCATGCGCTTACTGGCAAGCCCGGGCATCAATGAGTGGCTGAATACGCATGGCACCGTACGATCG
GCACTGGCGGGCCTGTACGGGCGCGACCTTCGTCTGCCGCCAGCGCGGTTCCGCTGGTTAAAGGGCTGCG
ACCGTAGCCTCTGGTACGGACTGCACACTGCAGATACAGCAAAGGTATTTGTTGAAGGATCGGGGATCAT
CGCGCAGGCACGTGCAGAGATAAAGGCCGCAAAAATGGGACTGCCACGACCGGCACTAATGACGGATGAG
GCTATAGCAGGACTGCAGCTTGAGCTGGAGCAGCTGGACCTTGTTTATCCGCGGGACCAGCGTCAGCTGC
CTGTAAAACGTAAGTACCAAGTCACCTTCCCTGACTCCCTCTATATGCCCGAACAGGGCGATGACGAACT
TTCTGACGGCGCCGGCGCGCGCTGA
 Primer design