SecReT4
Protein ID: 293386503
T4SS name [ID]Tra_I [175]
Gene symboltrbB
Locus tagEAM_P284
StrainErwinia amylovora ATCC 49946
Repliconplasmid 2 [GenBank: NC_013973] [Browse all T4SS(s) in this replicon]
Location [Strand]67127..68170 [+]
Productconjugal transfer protein
Component typeTrbB_I
UniProt IDD4IGX0
KEGG IDeay:EAM_P284
PDB IDNA
Domain hit(s) vs Pfam Thioredoxin_2 [PF13098], Evalue: 4.1e-05, Aligned region: 200..328
Protein Sequence: 347 a.a.     [Download]
>gi|293386503|ref|YP_003540665.1| conjugal transfer protein [Erwinia amylovora ATCC 49946]
MTIIRKEGLFVAEISEGLLSTRRFIAEQGWGKGGESYTNCASLPLFTFSVSQLPWFVVHGDGLYAQNAHD
ALTPLYRGEDASQLLECITNALRNTSKRRRRWERGLLIAAVLLAASAAVSVSFIFPHYSERPQLQVGPVN
LAPPAPAPSSPVRNEAPMAQQGAVPANNWSLPVSARATLPAKLRSAASRGMFTIPLSSGHARTLYVFADP
LCVNCQRMERHFETAAGMVNVVIFPVTIEGRNASLQTLTPVMLLPEAERAAAWKHLFSADAGMPVPGRMQ
DTAPAAGKEKTELVQGAIGVNEVAYRAYRLPGTPWTISDDGRHVPQAVLSSPASLEAFLKEGAADGQ
 
Nucleotide Sequence: 1044 bp     [Download]
>ref|NC_013973.1|:67127-68170 conjugal transfer protein [Erwinia amylovora ATCC 49946]
ATGACCATTATTCGCAAAGAAGGCCTGTTCGTGGCTGAAATCAGCGAAGGGCTGCTGAGCACCCGCCGTT
TCATTGCAGAGCAGGGCTGGGGTAAGGGCGGAGAAAGCTATACCAACTGCGCATCTCTGCCGCTTTTTAC
CTTTTCCGTTTCTCAGCTTCCATGGTTCGTAGTGCATGGTGATGGCCTTTATGCTCAGAACGCGCACGAC
GCGCTGACTCCACTGTACAGAGGAGAAGATGCCTCGCAGCTGCTGGAGTGCATAACGAACGCACTGCGTA
ACACATCAAAGCGCCGGCGCCGCTGGGAGCGTGGCTTATTGATCGCGGCTGTGTTACTTGCAGCAAGTGC
TGCAGTGTCAGTGTCATTCATATTTCCTCACTACAGTGAACGCCCTCAACTTCAGGTCGGCCCCGTTAAC
CTGGCACCGCCCGCGCCAGCACCATCGTCGCCTGTCAGAAATGAAGCACCGATGGCCCAACAGGGCGCAG
TGCCTGCTAATAACTGGAGCCTGCCAGTTTCCGCGCGCGCTACATTGCCTGCGAAGCTCAGAAGCGCGGC
TTCACGAGGCATGTTCACGATTCCGCTGTCCTCAGGACATGCTCGCACCCTGTACGTTTTCGCGGATCCG
TTATGTGTGAATTGTCAGCGCATGGAGCGTCATTTCGAAACGGCGGCCGGCATGGTTAACGTGGTGATAT
TCCCGGTGACTATTGAAGGGCGTAACGCTTCATTGCAGACACTGACACCTGTCATGCTGCTGCCGGAAGC
AGAGCGCGCAGCTGCCTGGAAACACCTTTTTTCTGCTGATGCCGGTATGCCCGTGCCTGGCAGGATGCAG
GATACTGCGCCGGCTGCAGGCAAAGAAAAAACAGAGCTGGTGCAGGGCGCCATAGGCGTCAATGAAGTGG
CATACCGCGCCTACAGGCTGCCCGGAACACCCTGGACGATATCCGACGACGGACGCCATGTACCGCAGGC
GGTGCTGAGTTCTCCCGCCTCCCTTGAAGCTTTTTTGAAGGAGGGTGCAGCTGATGGACAATAA
 Primer design