SecReT4
Protein ID: 293386504
T4SS name [ID]Tra_I [175]
Gene symboltrbC
Locus tagEAM_P285
StrainErwinia amylovora ATCC 49946
Repliconplasmid 2 [GenBank: NC_013973] [Browse all T4SS(s) in this replicon]
Location [Strand]68160..70361 [+]
Productconjugal transfer protein
Component typeTrbC_I
UniProt IDD4IGX1
KEGG IDeay:EAM_P285
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 5.1e-08, Aligned region: 442..569
T4SS-DNA_transf [PF02534], Evalue: 6.7e-06, Aligned region: 124..284
AAA_10 [PF12846], Evalue: 1.9e-05, Aligned region: 137..513
Protein Sequence: 733 a.a.     [Download]
>gi|293386504|ref|YP_003540666.1| conjugal transfer protein [Erwinia amylovora ATCC 49946]
MDNKSAIDNDRISRHVGRSWITEALAEIGTLAFGMIALTCAGIVWPVTLLLSLPILLFWSLVVVPSGRWK
MPMRMPADMNRLDPSTERKVPAKLLGFLPVTTPRIYTGRAAGILYAGYLRGKDAGRELWLSMDDLTRHVL
MFATTGAGKTETLLGWVLNALCWGKGVIFSDHKAQNDVALAMMSMARRFGREDDLRIMNFITGGRSRAQE
LLDNVKTRPQTNTTSIFGLAQETYIVNLMDSMLPKTGGNGGEWQEKAKAMNQALIFALVYKCRREGTVMS
QRTIQTHLPLRKIAGLYIQAVEEQWHEEIRHALENYLSTLAGFDMEKVSTPSEWHPDSNLQHGYLMQQFT
RMLTLFNDTYGHVFARDAGDIDLRDVVHNDRIMIVLVPALELSAAEGSTLGRLYQSQLAMILSQDLGEKL
EGRPQDNMKVRKFKDRFPLLWIIDEVGAGYSEKVGELATQIRSLGYCLLLAGQEVQRLKTAAGDAVWTLI
ANMGTRITGKIMDPKDTLEILQLMAGTEYRAHMGSMVQQGGIMGGWSDDTRLQVSEKKKVDVEEVQALQE
GEQVTLFKGKILRNSSLYIEDTDKFSQADVRINRFVEVSAPSERALLATMPFRQRRSFVREERVQHILRV
LDAAPGAHDTSGLVLTDPALAAVGEFNMECAFVWRRSPSAAVRSAILWRMVQESLPARGKGYSTRLRVPR
SLGASRESIDAAMLNHVEPVRDKASADRPRQFA
 
Nucleotide Sequence: 2202 bp     [Download]
>ref|NC_013973.1|:68160-70361 conjugal transfer protein [Erwinia amylovora ATCC 49946]
ATGGACAATAAATCGGCTATAGACAACGATCGTATCAGCCGGCACGTCGGTCGCTCATGGATTACCGAAG
CTCTGGCAGAAATTGGCACGCTCGCTTTTGGCATGATTGCGCTCACCTGCGCCGGCATTGTCTGGCCAGT
TACTCTGCTGCTGAGCCTGCCGATACTGCTGTTCTGGTCCTTGGTTGTAGTGCCTTCCGGACGCTGGAAG
ATGCCTATGCGCATGCCTGCTGACATGAACCGGCTCGATCCCTCCACTGAGCGAAAGGTCCCGGCAAAAT
TGCTGGGTTTTCTGCCGGTGACGACCCCGCGCATTTACACCGGACGCGCAGCAGGAATTCTGTACGCGGG
TTATCTCCGCGGGAAAGACGCCGGCCGTGAACTGTGGCTCTCGATGGATGATCTGACACGACACGTACTG
ATGTTTGCCACCACCGGCGCCGGCAAAACAGAGACACTACTCGGCTGGGTACTGAACGCGCTCTGCTGGG
GTAAGGGCGTTATCTTCTCCGACCATAAAGCGCAGAACGATGTGGCGCTGGCCATGATGTCTATGGCCCG
ACGTTTCGGCCGCGAGGATGATCTGCGCATTATGAACTTCATCACAGGTGGACGCTCGCGTGCGCAGGAG
CTACTTGATAACGTGAAAACCCGCCCGCAGACGAACACTACCAGTATCTTTGGGCTGGCGCAGGAAACCT
ACATCGTTAACCTGATGGACTCCATGCTTCCCAAAACTGGCGGAAACGGCGGGGAATGGCAGGAGAAAGC
AAAAGCGATGAACCAGGCGCTGATATTTGCGCTGGTTTATAAGTGCCGACGCGAAGGCACGGTGATGTCC
CAGCGCACGATCCAGACGCACCTGCCGCTACGTAAAATAGCCGGCCTGTATATCCAGGCGGTTGAGGAGC
AATGGCACGAGGAAATCCGACACGCGCTGGAGAACTACCTCAGCACGCTTGCCGGTTTTGACATGGAAAA
GGTCTCAACTCCGTCAGAATGGCATCCTGATTCAAACCTGCAGCACGGCTACCTGATGCAGCAGTTCACG
CGCATGCTGACGCTTTTTAACGATACCTACGGACACGTGTTCGCCCGGGATGCGGGGGATATCGACCTGC
GCGATGTGGTGCATAACGATCGCATCATGATAGTCCTCGTGCCGGCACTGGAGCTGTCGGCCGCTGAGGG
CTCCACGCTTGGTCGGCTCTATCAGTCTCAGCTGGCCATGATCCTCAGTCAGGACCTCGGCGAGAAACTG
GAGGGGCGCCCTCAGGACAACATGAAGGTCCGTAAGTTTAAGGACCGCTTTCCACTGCTCTGGATTATTG
ACGAGGTAGGTGCTGGCTACAGCGAAAAGGTTGGTGAGCTGGCCACGCAAATCCGCTCGCTGGGCTACTG
CTTGCTTCTGGCCGGTCAGGAGGTTCAGCGCCTAAAAACGGCAGCGGGCGATGCTGTCTGGACGCTTATT
GCCAACATGGGCACGCGTATCACCGGCAAGATAATGGATCCCAAGGATACGCTAGAAATTCTGCAGTTGA
TGGCCGGCACAGAGTATCGCGCGCACATGGGCTCGATGGTCCAGCAGGGCGGGATAATGGGCGGCTGGAG
TGATGACACGCGCCTGCAGGTAAGCGAAAAGAAAAAAGTAGACGTCGAAGAGGTGCAAGCCCTGCAGGAG
GGCGAGCAGGTCACCCTGTTTAAGGGAAAGATCCTGCGTAACAGCTCACTTTATATCGAGGACACCGATA
AGTTTTCGCAGGCGGACGTGCGTATTAACCGCTTTGTAGAGGTATCAGCGCCATCAGAGCGGGCCTTGCT
GGCCACGATGCCATTCCGGCAGCGCCGTAGCTTTGTGCGCGAGGAGAGGGTACAGCACATTCTGCGCGTC
CTGGACGCTGCGCCGGGCGCTCATGACACCAGTGGGCTGGTTCTGACCGATCCAGCGCTGGCTGCAGTGG
GCGAATTTAATATGGAATGTGCCTTCGTCTGGCGCCGCTCACCGTCTGCAGCTGTGCGCTCAGCCATCCT
CTGGCGCATGGTTCAGGAAAGCCTGCCTGCCAGAGGCAAGGGCTATAGCACTCGTCTGCGCGTGCCTCGT
TCGTTGGGAGCTTCTCGCGAGAGCATCGATGCCGCAATGCTCAATCACGTTGAGCCAGTACGGGATAAAG
CCAGCGCTGACCGGCCCAGGCAGTTTGCCTGA
 Primer design