SecReT4
Protein ID: 29376404
T4SS name [ID]Tra_Tn [671]
Gene symbol-
Locus tagEF1875
StrainEnterococcus faecalis V583
Repliconchromosome [GenBank: NC_004668] [Browse all T4SS(s) in this replicon]
Location [Strand]1819850..1820761 [-]
Producthypothetical protein
Component typeOrf13_Tn
UniProt IDQ833R5
KEGG IDefa:EF1875
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 2.4e-55, Aligned region: 76..300
Protein Sequence: 303 a.a.     [Download]
>gi|29376404|ref|NP_815558.1| hypothetical protein EF1875 [Enterococcus faecalis V583]
MKIKIERIQKEKMSKKKKERTISVGKHRKMVLALWLLLSCSLAFGIYKYFTAIDQHTTHVKMVVKEKVIN
TSGVESFTKNFVKEYFSWKNNKEVIEKRMSNLGQYLTEEGLALSQDMVRVDIPTSSEVNSVKILDVEKRS
KDFVVSFLVDQKITEGKKSEQISSAYRVKIFEDEKENHIVTSLPTMISKPGKAKYEVKQVESDSDIDAKT
TQEITEFLETFFKLYPTASEKELEYYSENESMSQVSSDLRFVEITNPIYLEKDGSVQVKIVVKYLNEIEK
VTNSFQYNLLLNKEENWKIINGE
 
Nucleotide Sequence: 912 bp     [Download]
>gi|29374661|ref|NC_004668.1|:c1820761-1819850 Enterococcus faecalis V583 chromosome, complete genome
ATGAAGATAAAAATTGAACGGATTCAAAAGGAAAAGATGTCAAAAAAGAAAAAAGAGCGGACAATTTCAG
TGGGCAAGCATCGAAAAATGGTGCTTGCCCTTTGGCTTTTACTGTCATGTAGTCTTGCTTTTGGTATCTA
CAAATATTTCACCGCCATTGATCAGCATACAACTCACGTAAAAATGGTTGTAAAAGAAAAAGTAATAAAT
ACTTCTGGAGTTGAAAGTTTTACAAAGAATTTTGTGAAAGAATACTTTTCATGGAAGAATAACAAGGAAG
TAATTGAAAAGAGAATGAGTAATCTTGGACAGTACCTTACAGAAGAAGGCCTTGCTTTGAGTCAAGATAT
GGTTCGAGTAGATATTCCCACTAGTTCAGAAGTAAACTCAGTAAAAATTCTAGATGTTGAAAAACGTTCG
AAAGATTTTGTCGTTTCATTTTTAGTAGACCAAAAGATTACAGAAGGGAAAAAGTCAGAACAAATTTCTT
CTGCGTATCGAGTGAAGATATTTGAAGATGAAAAAGAAAATCATATAGTGACGAGTTTACCAACTATGAT
TAGTAAGCCAGGTAAGGCAAAATATGAAGTAAAACAAGTAGAAAGTGATTCTGACATTGATGCAAAAACA
ACGCAAGAAATTACTGAGTTTCTAGAGACATTTTTCAAACTTTATCCAACTGCTTCTGAAAAAGAGCTAG
AGTATTATAGTGAAAATGAATCTATGAGCCAAGTTAGTAGCGATCTTAGATTTGTAGAAATAACCAATCC
TATTTATCTTGAAAAGGACGGTTCGGTACAAGTAAAAATCGTAGTAAAATACCTAAATGAAATTGAAAAG
GTGACAAATAGTTTTCAATACAATCTATTGTTAAACAAAGAAGAAAATTGGAAAATTATTAATGGAGAAT
AA
 Primer design