SecReT4
Protein ID: 29376405
T4SS name [ID]Tra_Tn [671]
Gene symbol-
Locus tagEF1876
StrainEnterococcus faecalis V583
Repliconchromosome [GenBank: NC_004668] [Browse all T4SS(s) in this replicon]
Location [Strand]1820780..1821784 [-]
ProductNLP/P60 family lipoprotein
Component typeOrf14_Tn
UniProt IDQ833R4
KEGG IDefa:EF1876
PDB IDNA
Domain hit(s) vs Pfam Lysozyme_like [PF13702], Evalue: 1.3e-58, Aligned region: 48..204
NLPC_P60 [PF00877], Evalue: 9.5e-29, Aligned region: 226..331
Protein Sequence: 334 a.a.     [Download]
>gi|29376405|ref|NP_815559.1| NLP/P60 family lipoprotein [Enterococcus faecalis V583]
MNLKELSVISLTMLMLSFMGILMCVSLLFGEDSEGSGTSGISPGGNSVSEEVLKHRSMVEKYAKESDILD
YVPILLAIIQVESGGTMEDVMQSSESAGLPPNSLSTEASIKQGCIYFASLVKSSKELGCDQDSIIQAYNY
GGGYLNYVAKNGKKHSFTLAESFSKEKSGGQKVDYPNPIAIKENGGWRYNYGNMFYCLLVKQYLTTTQFD
DKTVQGIFDEAFKYEGTAYVFGGSSPATGFDCSGLTQWCYAKVGLKLPRVAQDQYDVMTHIDLKDAKPGD
LIFFHSTYDAGTYVTHVGIYAGENRMFHAGNPVGWTNLTESYWQQHLIGAGRYN
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|29374661|ref|NC_004668.1|:c1821784-1820780 Enterococcus faecalis V583 chromosome, complete genome
ATGAATTTAAAAGAATTGAGTGTCATTTCGTTAACCATGTTGATGCTCTCTTTTATGGGCATCTTGATGT
GTGTAAGCTTATTGTTTGGGGAAGATAGTGAGGGGAGTGGTACTTCTGGTATTTCTCCTGGTGGCAATAG
TGTCTCAGAAGAAGTCTTGAAACATCGCTCAATGGTTGAAAAATATGCTAAAGAATCGGACATATTAGAC
TATGTACCAATTCTTTTGGCAATCATCCAAGTTGAATCTGGTGGCACAATGGAGGACGTCATGCAAAGTT
CTGAGTCTGCGGGTTTACCACCAAATTCATTAAGTACCGAAGCATCTATCAAGCAGGGATGTATTTATTT
TGCTTCCTTGGTTAAGAGCTCCAAAGAACTAGGGTGTGATCAAGATAGTATTATTCAAGCCTATAACTAT
GGTGGCGGCTATTTGAATTATGTCGCAAAAAACGGGAAGAAGCATAGTTTTACTTTAGCCGAATCATTTT
CAAAGGAAAAATCGGGTGGTCAAAAAGTAGACTACCCCAACCCAATAGCGATTAAAGAAAATGGCGGGTG
GCGCTATAACTATGGCAATATGTTTTATTGCCTATTAGTGAAGCAATACCTGACCACGACACAGTTTGAT
GATAAAACAGTCCAAGGGATTTTTGACGAGGCTTTTAAGTATGAAGGTACTGCCTACGTATTTGGCGGTT
CGAGTCCCGCAACGGGTTTTGATTGTAGTGGATTGACCCAGTGGTGTTATGCCAAAGTTGGTCTGAAACT
TCCCCGGGTGGCTCAAGATCAGTATGATGTCATGACTCATATTGACTTAAAAGATGCCAAACCTGGTGAT
TTAATTTTCTTTCACTCAACCTATGATGCCGGTACTTATGTGACTCATGTAGGTATTTATGCAGGAGAGA
ATCGCATGTTTCACGCAGGAAATCCAGTGGGTTGGACGAATCTTACAGAAAGCTATTGGCAGCAGCATCT
GATTGGAGCCGGCCGATACAATTAA
 Primer design