SecReT4
Protein ID: 29376406
T4SS name [ID]Tra_Tn [671]
Gene symbol-
Locus tagEF1877
StrainEnterococcus faecalis V583
Repliconchromosome [GenBank: NC_004668] [Browse all T4SS(s) in this replicon]
Location [Strand]1821781..1823904 [-]
Producthypothetical protein
Component typeOrf15_Tn
UniProt IDQ833R3
KEGG IDefa:EF1877
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 707 a.a.     [Download]
>gi|29376406|ref|NP_815560.1| hypothetical protein EF1877 [Enterococcus faecalis V583]
MKKKLFRIVGIVFISILTLIVLLSLVGTVAEATGLVDDTVESGNLYSKYSLNNYQLDFFVDSSWDWLPWN
WGDGLGKSVMYGLYAITNFIWTVSLYLSNATGYVVQEAYKLDFISDTAESIGKNIQTLADITENGLQTSG
FYFGFLLLMILALGVYVAYTGLLKRETTKAVRAVINFVMIFLLSGSFIAYAPTYITKINDFSSDVSEAAL
TLGTEIVVPNSESQGKDSVDLIRDSLFSIQVQQPWLLLQFDDSNIEEIGEDRVNKILSVSPDENKGKDRE
EAVKAEIEDNDNANLSITKTMNRLGIVVFLVLFNIGISFFVFLLTGIMLFSQILFIIFAMFLPISFLLSM
LPTYESLGKMAIIRLFNTIMMRAGVTLVITTAFSISTMFFNISATYPFFMVAFLQIVTFAGIYFKLGDIM
SMFNLQSNDSQSMGRRVMRRPQMLMNRKLRQLNRNVGRTLAFGGAAAVGNKLAKEQSKPKFKPAGSSLRK
NSRLPNDREVSSDSAKENPISNNKKQSRMNLTGRKIGKVLDTQALVKDKAKQVKDQVRNTPTNLKYILHK
GLEKTKKAPKEFKRGLVQEKADREKLRDKQRQRRDEKMDEKRKNLGEVTDRHGKRRSNVSIKEDPKPQKD
RILKNELPKRIVMVKPNSEVRRRLVKQNLVARENNQLLSKKNSFQQVKQRSTLPKRANQKVQRIMKARPK
PKSGDKK
 
Nucleotide Sequence: 2124 bp     [Download]
>gi|29374661|ref|NC_004668.1|:c1823904-1821781 Enterococcus faecalis V583 chromosome, complete genome
ATGAAAAAGAAACTTTTTCGGATTGTGGGAATCGTTTTTATTAGCATACTCACTCTGATAGTTCTATTGA
GTTTAGTTGGTACGGTAGCCGAGGCGACAGGGCTAGTTGATGATACAGTTGAATCAGGAAATCTATATTC
CAAATATTCACTGAACAACTATCAACTAGATTTCTTTGTGGATAGCTCTTGGGATTGGTTGCCTTGGAAT
TGGGGTGATGGCTTAGGGAAAAGCGTGATGTATGGTCTTTATGCCATTACTAATTTCATTTGGACGGTGA
GTTTGTATTTGTCGAACGCCACGGGTTATGTGGTTCAAGAAGCCTATAAATTAGATTTCATTTCGGATAC
GGCTGAAAGTATTGGAAAGAATATCCAAACATTGGCTGATATTACTGAAAATGGACTCCAGACCTCCGGA
TTTTATTTTGGGTTTCTATTATTGATGATTTTAGCTCTGGGGGTGTATGTGGCGTATACCGGATTATTAA
AACGAGAAACCACGAAAGCAGTTCGAGCCGTGATTAATTTTGTGATGATTTTTCTACTATCGGGTTCGTT
CATTGCTTATGCGCCTACCTATATCACAAAAATCAATGACTTTAGCTCAGATGTTAGTGAAGCGGCCCTT
ACCCTTGGAACCGAGATCGTTGTACCCAATTCAGAAAGCCAAGGAAAAGATAGTGTGGATTTGATTCGGG
ATAGTTTGTTTTCGATTCAAGTCCAACAACCTTGGTTACTACTGCAATTTGATGATTCCAACATAGAAGA
AATTGGTGAAGACCGGGTCAACAAGATTCTATCTGTGAGTCCAGATGAAAACAAAGGCAAAGATCGGGAA
GAAGCGGTCAAGGCAGAGATTGAAGACAATGACAATGCGAATCTCAGTATTACCAAGACCATGAACCGTT
TAGGGATCGTGGTCTTTTTGGTATTGTTCAATATTGGCATTTCCTTCTTTGTTTTTCTTCTAACAGGGAT
TATGTTGTTCTCGCAAATTCTCTTCATTATCTTTGCGATGTTTCTGCCAATTAGTTTCTTATTGTCCATG
TTGCCGACTTATGAGAGTTTGGGCAAGATGGCGATTATTCGTTTATTCAATACGATTATGATGCGAGCGG
GTGTCACCTTGGTGATTACGACTGCATTCAGTATTTCTACGATGTTTTTCAATATTTCGGCTACCTATCC
CTTCTTTATGGTAGCTTTTCTACAAATTGTGACCTTTGCCGGTATCTATTTCAAATTGGGTGACATTATG
AGTATGTTCAACCTTCAGAGTAATGACAGTCAGTCAATGGGCAGACGGGTCATGCGAAGACCGCAAATGT
TGATGAACCGTAAATTGCGGCAACTCAATCGAAATGTGGGCCGAACTCTGGCTTTTGGCGGTGCTGCAGC
AGTTGGGAATAAGTTGGCAAAGGAACAATCAAAACCCAAATTTAAGCCAGCAGGTTCTTCTCTACGAAAG
AATTCACGATTACCTAACGATCGCGAGGTATCCTCAGACTCGGCTAAGGAGAATCCAATTTCAAATAATA
AGAAACAATCCCGAATGAATTTGACTGGGAGAAAAATAGGCAAAGTTCTGGATACCCAGGCTTTGGTGAA
AGATAAGGCAAAACAAGTAAAGGATCAGGTACGGAATACGCCGACCAACTTGAAATACATCCTCCATAAA
GGTCTGGAAAAGACGAAAAAAGCACCGAAAGAATTTAAGCGAGGGCTTGTTCAAGAAAAAGCAGATCGAG
AGAAGCTGCGAGACAAACAACGACAACGCAGAGATGAGAAAATGGATGAAAAGCGAAAAAACTTGGGCGA
AGTAACAGACCGTCATGGAAAAAGAAGAAGTAATGTTTCGATAAAAGAGGATCCAAAACCTCAGAAGGAT
AGGATACTGAAAAATGAACTTCCAAAACGGATTGTGATGGTAAAACCGAATTCTGAGGTAAGGAGAAGAC
TTGTTAAACAGAATTTGGTTGCGAGAGAGAATAACCAACTATTAAGTAAGAAAAATTCTTTCCAGCAAGT
TAAGCAACGATCTACTCTTCCGAAGAGAGCCAATCAAAAAGTACAAAGAATAATGAAGGCTCGTCCAAAA
CCAAAGTCGGGTGATAAAAAATGA
 Primer design