SecReT4
Protein ID: 29376407
T4SS name [ID]Tra_Tn [671]
Gene symbol-
Locus tagEF1878
StrainEnterococcus faecalis V583
Repliconchromosome [GenBank: NC_004668] [Browse all T4SS(s) in this replicon]
Location [Strand]1823909..1826356 [-]
ProductATP/GTP-binding protein
Component typeOrf16_Tn
UniProt IDQ833R2
KEGG IDefa:EF1878
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 9.3e-36, Aligned region: 467..762
Protein Sequence: 815 a.a.     [Download]
>gi|29376407|ref|NP_815561.1| ATP/GTP-binding protein [Enterococcus faecalis V583]
MYPIKYVENNLVFNQEGECFAYYELVPYNYSFLSPEQKYQVHDNFRQLIAQNREGKIHALQIATESSIRA
TQERSKKEITGRLKEVAKQRIDLQTDALVSMIGDSQIDYRFFIGFKLIATDEEVNLKSLKKSFLSGLQEF
VYGVNHHLMGDFVSLSNEEIRRYTKLEKLMESKLARRFKVRRVTPSDLTYLIEHIYGEKGTPFEEYEFQL
PKKKLKSETLVKRYDLLHPSRCLIEENPRYLRMEHENHESYVAYLTINTIVGEMEFPSSELFYYQQQQFT
FPIDTSMNVEIVTNKKALATVRNKKKELKDLDNHAYQSDNETNSNVLDALDSVNELETTLDQSKESMYKL
SYVVRVSAESVDELKRRCDEVFDFYDDTNVKLVRPFGDMMGLHEEFLPSSKRYMNDYIQYVTSDFLAGLG
FGATQKLGELEGIYFGYNVDTGRNVYLKPALASQGVKGSVTNALAAAFLGSLGGGKSFSNNLLVYYAVLF
GGQAVIVDPKGERGGWKENLPEIADEINILNLTSKPENQGLLDPYVIMKKKKDSESLAIDILTFLTGISS
RDGEKFPVLRKAIRTVTQSDQRGLLQVINELRKENSPVAENIADHIESFTDYDFAHLLFSDGSITQSISL
DKQLNIIQVADLVLPDAETTFEEYTTMELLSVSMLIVISTFALDFIHSNREIFKIVDLDEAWSFLQVAQG
KTLSNKLVRAGRAMNAGVYFVTQNSDDLLDERLKNNIGLKFAFRSTDIHEIKKTLEFFGLDQEDESNQKR
LRDLENGQCLMQDLYGRVGVVQVHPVFEELFHAFDTRPPVQERME
 
Nucleotide Sequence: 2448 bp     [Download]
>gi|29374661|ref|NC_004668.1|:c1826356-1823909 Enterococcus faecalis V583 chromosome, complete genome
ATGTACCCGATTAAGTATGTTGAAAATAATCTTGTCTTTAATCAAGAGGGAGAATGTTTTGCCTACTATG
AACTTGTGCCTTATAACTATTCCTTCTTATCGCCTGAACAGAAGTATCAAGTGCACGATAACTTTCGTCA
ATTGATTGCTCAGAATCGTGAAGGCAAGATCCATGCCTTACAAATTGCCACAGAAAGTAGTATTCGTGCC
ACGCAAGAACGATCAAAAAAGGAAATTACAGGCAGACTCAAAGAAGTCGCGAAACAACGAATTGACCTTC
AAACAGATGCATTAGTATCTATGATTGGCGATAGTCAGATTGATTATCGCTTTTTTATTGGCTTTAAACT
AATTGCAACAGATGAAGAGGTCAATTTAAAGAGTCTCAAGAAATCTTTCCTTTCTGGGCTTCAAGAATTT
GTCTATGGGGTGAACCATCATTTGATGGGTGATTTTGTTTCCTTATCCAATGAAGAAATTCGCCGATATA
CCAAGCTTGAAAAACTAATGGAAAGTAAATTGGCTAGAAGATTCAAAGTCAGACGGGTCACACCGAGTGA
TCTGACGTATTTAATTGAACATATTTATGGCGAAAAAGGCACACCGTTTGAAGAATATGAATTTCAGCTA
CCAAAGAAAAAGCTAAAATCAGAAACGCTGGTGAAACGTTATGATTTATTACATCCTAGTCGTTGCTTGA
TTGAAGAAAATCCTCGGTACTTACGCATGGAACATGAAAATCATGAATCGTATGTAGCCTATTTGACAAT
CAATACGATTGTAGGGGAGATGGAGTTTCCTTCTTCAGAACTTTTTTATTACCAGCAACAACAATTCACT
TTTCCCATTGATACTTCAATGAATGTGGAGATTGTGACCAATAAAAAAGCTCTTGCCACTGTTCGCAATA
AGAAAAAAGAACTGAAAGATTTAGACAACCATGCCTACCAATCCGATAATGAGACAAATTCCAATGTCTT
AGATGCTTTGGATTCAGTAAATGAGTTGGAAACTACCTTGGATCAATCCAAGGAGTCGATGTACAAATTA
AGTTATGTAGTTCGAGTGAGTGCGGAATCCGTGGATGAATTAAAACGCCGTTGTGATGAAGTGTTCGATT
TTTATGATGATACTAATGTAAAACTAGTCCGACCCTTTGGCGATATGATGGGGCTACATGAAGAATTCTT
GCCCTCAAGCAAACGCTATATGAACGATTATATCCAATATGTTACTTCTGACTTTTTAGCGGGACTTGGT
TTTGGGGCTACTCAAAAGCTAGGGGAATTAGAAGGCATCTACTTTGGCTACAATGTAGATACGGGGCGGA
ATGTTTACCTGAAACCGGCATTAGCTTCACAAGGGGTCAAGGGTTCAGTTACCAATGCTTTGGCTGCTGC
GTTCCTTGGTTCACTCGGTGGCGGAAAATCCTTTAGTAACAATCTCTTGGTCTACTATGCTGTTCTTTTT
GGTGGCCAAGCTGTGATTGTCGATCCAAAAGGAGAACGAGGTGGTTGGAAAGAAAACTTGCCAGAAATTG
CGGATGAAATCAATATTCTCAACTTGACTAGTAAACCAGAAAATCAAGGCTTACTTGATCCTTATGTGAT
TATGAAGAAAAAGAAAGATTCAGAAAGTTTAGCAATTGATATCCTGACTTTTTTAACAGGAATTTCCAGT
CGGGATGGGGAGAAGTTTCCAGTATTGCGCAAAGCCATTCGGACGGTTACCCAAAGTGATCAACGAGGAT
TGCTGCAAGTCATTAATGAGCTTCGAAAGGAGAACTCTCCAGTCGCGGAAAATATCGCCGATCATATCGA
GTCCTTTACCGATTATGATTTTGCCCATTTGCTTTTCTCAGATGGTTCGATTACCCAATCAATTAGTTTA
GATAAGCAGTTGAATATCATTCAAGTAGCGGATTTGGTTTTACCAGATGCAGAAACCACTTTTGAAGAAT
ATACCACGATGGAGTTGCTAAGTGTCTCTATGCTAATCGTCATTTCCACGTTTGCCTTGGATTTTATCCA
TAGTAATCGAGAAATCTTCAAGATTGTGGACCTGGATGAGGCTTGGAGTTTTCTTCAAGTGGCTCAAGGA
AAGACCCTTTCAAATAAGCTCGTTCGTGCTGGTCGGGCCATGAATGCCGGTGTTTACTTTGTCACGCAAA
ATAGTGACGATTTACTGGATGAACGCTTGAAGAATAATATCGGATTGAAATTTGCTTTTCGTAGTACCGA
TATTCATGAAATCAAGAAGACTTTGGAATTTTTTGGGTTGGATCAAGAAGATGAAAGTAATCAAAAACGC
CTACGAGATTTGGAAAACGGCCAATGCTTGATGCAGGATTTGTATGGTCGGGTAGGCGTGGTTCAGGTAC
ATCCAGTCTTTGAAGAACTCTTCCATGCCTTTGATACCCGTCCACCTGTTCAAGAGAGAATGGAGTGA
 Primer design