SecReT4
Protein ID: 29376408
T4SS name [ID]Tra_Tn [671]
Gene symbol-
Locus tagEF1879
StrainEnterococcus faecalis V583
Repliconchromosome [GenBank: NC_004668] [Browse all T4SS(s) in this replicon]
Location [Strand]1826343..1826732 [-]
Producthypothetical protein
Component typeOrf17_Tn
UniProt IDQ833R1
KEGG IDefa:EF1879
PDB IDNA
Domain hit(s) vs Pfam TcpE [PF12648], Evalue: 1.5e-33, Aligned region: 6..107
Protein Sequence: 129 a.a.     [Download]
>gi|29376408|ref|NP_815562.1| hypothetical protein EF1879 [Enterococcus faecalis V583]
MKKIKSYTSIWAVEKVIYAINDFQLPFPVTFNQMAWFVLSLLFVIVFAHVPPLSMIEGAFLKYLGIPVVV
TWFMSQKTFDGKKPLGFLRSFLSYHLRFKVTFAGKKVKEQKKRWDEPITLVRSVNYVPD
 
Nucleotide Sequence: 390 bp     [Download]
>gi|29374661|ref|NC_004668.1|:c1826732-1826343 Enterococcus faecalis V583 chromosome, complete genome
ATGAAAAAAATAAAAAGCTACACCAGTATCTGGGCAGTTGAAAAGGTCATTTATGCAATCAATGACTTTC
AGCTACCTTTTCCTGTGACCTTTAATCAGATGGCTTGGTTTGTTTTGTCCTTGCTGTTTGTCATCGTTTT
TGCCCATGTGCCTCCGCTATCTATGATAGAGGGGGCCTTTTTAAAATACTTAGGCATACCGGTGGTGGTC
ACTTGGTTCATGTCGCAAAAAACCTTTGATGGTAAGAAACCACTGGGATTTTTACGATCCTTTCTCAGTT
ATCACTTACGGTTTAAGGTCACTTTTGCAGGAAAGAAGGTCAAAGAACAGAAGAAACGATGGGATGAACC
CATCACTCTAGTAAGGAGTGTGAACTATGTACCCGATTAA
 Primer design