SecReT4
Protein ID: 29376419
T4SS name [ID]Tra_Tn [671]
Gene symbol-
Locus tagEF1890
StrainEnterococcus faecalis V583
Repliconchromosome [GenBank: NC_004668] [Browse all T4SS(s) in this replicon]
Location [Strand]1833534..1833890 [-]
Producthypothetical protein
Component typeOrf21_Tn
UniProt IDQ833Q1
KEGG IDefa:EF1890
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 118 a.a.     [Download]
>gi|29376419|ref|NP_815573.1| hypothetical protein EF1890 [Enterococcus faecalis V583]
MLTTKESAVILNKLKQIVMLGRQSGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSELGYSMMFGEVD
KNFFMKRIKGRGYVDTGGSVISEFYTPLVPKGYDFLESIKQVAQSKEK
 
Nucleotide Sequence: 357 bp     [Download]
>gi|29374661|ref|NC_004668.1|:c1833890-1833534 Enterococcus faecalis V583 chromosome, complete genome
ATGTTAACGACGAAAGAAAGTGCGGTGATTTTAAATAAGCTCAAACAAATCGTGATGTTGGGTCGTCAGT
CTGGTTTCTTTCTAATTCTGGCTTGTCAAAGACCGGATGCAAAATATTTAGGAGACGGGATTCGCGATCA
ATTTAACTTCCGAGTGGCTTTGGGTCGTATGAGTGAACTCGGGTATTCCATGATGTTTGGAGAAGTTGAT
AAAAATTTCTTTATGAAACGCATCAAAGGTCGAGGCTATGTGGATACTGGAGGGAGTGTGATTAGTGAGT
TTTATACGCCACTTGTGCCAAAAGGGTATGATTTCTTAGAATCCATCAAACAAGTAGCACAATCAAAAGA
AAAATGA
 Primer design