SecReT4
Protein ID: 29376419
T4SS name [ID]Tra_Tn [671]
Gene symbol-
Locus tagEF1890
StrainEnterococcus faecalis V583
Repliconchromosome [GenBank: NC_004668] [Browse all T4SS(s) in this replicon]
Location [Strand]1833534..1833890 [-]
Producthypothetical protein
Component typeOrf21_Tn
UniProt IDQ833Q1
KEGG IDefa:EF1890
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 118 a.a.     [Download]
>gi|29376419|ref|NP_815573.1| hypothetical protein EF1890 [Enterococcus faecalis V583]
MLTTKESAVILNKLKQIVMLGRQSGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSELGYSMMFGEVD
KNFFMKRIKGRGYVDTGGSVISEFYTPLVPKGYDFLESIKQVAQSKEK
 
Nucleotide Sequence: 357 bp     [Download]
>gi|29374661|ref|NC_004668.1|:c1833890-1833534 Enterococcus faecalis V583 chromosome, complete genome
ATGTTAACGACGAAAGAAAGTGCGGTGATTTTAAATAAGCTCAAACAAATCGTGATGTTGGGTCGTCAGT
CTGGTTTCTTTCTAATTCTGGCTTGTCAAAGACCGGATGCAAAATATTTAGGAGACGGGATTCGCGATCA
ATTTAACTTCCGAGTGGCTTTGGGTCGTATGAGTGAACTCGGGTATTCCATGATGTTTGGAGAAGTTGAT
AAAAATTTCTTTATGAAACGCATCAAAGGTCGAGGCTATGTGGATACTGGAGGGAGTGTGATTAGTGAGT
TTTATACGCCACTTGTGCCAAAAGGGTATGATTTCTTAGAATCCATCAAACAAGTAGCACAATCAAAAGA
AAAATGA
 Primer design

Protein ID: 29376420
T4SS name [ID]Tra_Tn [671]
Gene symbol-
Locus tagEF1892
StrainEnterococcus faecalis V583
Repliconchromosome [GenBank: NC_004668] [Browse all T4SS(s) in this replicon]
Location [Strand]1836459..1837475 [-]
ProductFtsK/SpoIIIE family protein
Component typeOrf21_Tn
UniProt IDQ820U4
KEGG IDefa:EF1892
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 8.4e-21, Aligned region: 188..330
DUF87 [PF01935], Evalue: 5.8e-06, Aligned region: 223..259
AAA_10 [PF12846], Evalue: 7.8e-06, Aligned region: 222..259
Protein Sequence: 338 a.a.     [Download]
>gi|29376420|ref|NP_815574.1| FtsK/SpoIIIE family protein [Enterococcus faecalis V583]
MYKEHRIRARDQHLVYHFILGWLIALLISWMGVFYFQEFRQFDISRVSLSTIETVWSMKELICLLGSLGF
SGAMLLLYIHFFPDHWRSLWHRQKLARMILENHWYEVKQTQSEGFFKDLNSSRTRETISYFPKIYYRMKE
GLLSIRVQISLGKYQEQLLKLEKKLESGLYCELVEKELKDSYVEYTLLYDMIANRIGIDEVVAENGTLRL
MKNQVWAYDSLPHMLIAGGTGGGKTYFLLTIIEALLKSDAELFILDPKNADLADLGTVMPHVYSQKEEIS
ACVEDFYERMIARSKAMKEMPNYKPGENYAYLGLPPNFLIFDEYVAYMGANRFPTSIE
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|29374661|ref|NC_004668.1|:c1837475-1836459 Enterococcus faecalis V583 chromosome, complete genome
ATGTACAAAGAACATCGCATACGTGCAAGAGATCAGCATTTGGTTTATCACTTTATTCTTGGCTGGCTAA
TTGCTTTGTTAATCAGTTGGATGGGTGTCTTTTATTTTCAAGAGTTTAGACAATTTGATATTTCTAGGGT
ATCACTTTCTACTATTGAAACTGTTTGGTCCATGAAGGAGTTAATCTGCTTACTTGGAAGTCTCGGTTTT
TCAGGAGCTATGCTGTTGCTTTATATTCACTTTTTTCCTGATCATTGGCGAAGCTTGTGGCATCGGCAAA
AACTAGCTCGGATGATTCTAGAAAACCATTGGTATGAAGTGAAACAAACTCAAAGTGAGGGCTTTTTCAA
AGATTTAAATAGTAGTCGAACCAGAGAGACTATCAGTTACTTCCCCAAAATCTATTATCGAATGAAGGAG
GGTTTACTTTCTATTCGCGTTCAAATTTCACTAGGGAAATATCAGGAGCAGCTATTGAAGTTGGAAAAGA
AGCTAGAAAGTGGATTGTATTGTGAGTTAGTAGAAAAGGAACTCAAAGACTCCTATGTGGAGTATACTTT
ACTGTATGATATGATCGCCAATCGAATTGGGATAGACGAAGTAGTGGCAGAAAATGGGACTCTGCGATTG
ATGAAAAATCAAGTATGGGCTTATGATTCTTTACCCCATATGTTAATCGCTGGTGGCACAGGTGGGGGGA
AGACCTATTTCCTCCTCACCATTATCGAAGCACTATTGAAGTCAGATGCAGAATTGTTTATCCTCGATCC
CAAAAATGCAGATTTAGCTGATTTAGGTACGGTGATGCCTCACGTATATTCTCAAAAGGAAGAAATTTCT
GCTTGTGTGGAAGATTTTTATGAACGCATGATAGCTCGTAGTAAGGCAATGAAAGAAATGCCCAACTACA
AACCAGGAGAAAATTATGCCTATCTTGGACTTCCACCAAACTTTTTAATCTTTGATGAATACGTGGCTTA
TATGGGTGCGAATCGTTTTCCTACAAGCATCGAATAG
 Primer design