SecReT4
Protein ID: 29376780
T4SS name [ID]Tra_Tn [672]
Gene symbol-
Locus tagEF2277
StrainEnterococcus faecalis V583
Repliconchromosome [GenBank: NC_004668] [Browse all T4SS(s) in this replicon]
Location [Strand]2197119..2198027 [-]
Producthypothetical protein
Component typeOrf13_Tn
UniProt IDQ832F3
KEGG IDefa:EF2277
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 3e-54, Aligned region: 75..299
Protein Sequence: 302 a.a.     [Download]
>gi|29376780|ref|NP_815934.1| hypothetical protein EF2277 [Enterococcus faecalis V583]
MKIKIERNKKKISGKKKEQVVSMGKHRKMVLVLWLLLLSSLSFGIYKNFTAIDQHTTHEKVVVKEKIVNT
SGVENFTVDFAKEYFSWKNDRVAIEKRIRSLGHYLTKDVLDLSQDMVRADIPTSSKVNSVKILNVEKKSK
WFVVSFLVDQEIVEEKKALQEKTAYRISVFEDRLGNCIVTSLPTMISKPVKANYKTKQFTDDSMIKEKNK
EEIEEFLEVLFKLYPTASKEELGYYVKKDVLEPIYKNLKFVEISSINYQKKGQAIKTNILVKYLDPTSKI
TSKFQYVLILQKAKKWEVIANE
 
Nucleotide Sequence: 909 bp     [Download]
>gi|29374661|ref|NC_004668.1|:c2198027-2197119 Enterococcus faecalis V583 chromosome, complete genome
ATGAAGATAAAAATAGAACGAAATAAAAAGAAGATTTCGGGAAAGAAAAAAGAACAAGTTGTTTCAATGG
GGAAGCATCGAAAAATGGTGCTTGTCCTTTGGTTATTACTTCTTAGTAGTTTATCCTTTGGAATCTACAA
AAATTTCACCGCTATTGATCAACATACAACTCATGAGAAAGTGGTTGTGAAGGAAAAAATTGTGAATACC
TCAGGTGTAGAAAATTTTACTGTAGATTTTGCCAAAGAATATTTCTCTTGGAAAAATGATAGAGTAGCAA
TTGAAAAAAGAATACGTTCTCTAGGGCATTATCTTACAAAAGATGTACTAGATTTAAGTCAAGATATGGT
TAGAGCAGATATACCAACAAGTTCTAAGGTGAACTCAGTGAAAATTCTAAATGTTGAGAAAAAGTCAAAA
TGGTTCGTCGTATCATTTTTGGTGGATCAAGAAATAGTAGAGGAAAAAAAAGCTTTACAAGAAAAAACAG
CATACCGAATTTCTGTTTTTGAAGATAGACTTGGAAATTGTATTGTGACTTCTTTGCCAACAATGATTAG
TAAACCTGTTAAAGCAAATTATAAAACTAAGCAGTTTACAGATGATTCGATGATTAAAGAAAAGAACAAA
GAAGAAATTGAAGAATTTTTAGAGGTTCTATTTAAATTATATCCAACAGCTTCTAAAGAAGAACTAGGAT
ATTATGTAAAAAAAGATGTGTTGGAGCCAATTTATAAGAATCTAAAGTTTGTTGAAATTAGCAGTATCAA
TTATCAGAAAAAAGGACAAGCAATAAAGACAAATATTTTAGTTAAATATCTTGATCCTACATCTAAGATT
ACATCAAAATTTCAATACGTTTTAATATTACAAAAAGCAAAAAAATGGGAAGTCATTGCTAATGAATGA
 Primer design