SecReT4
Protein ID: 29376781
T4SS name [ID]Tra_Tn [672]
Gene symbol-
Locus tagEF2278
StrainEnterococcus faecalis V583
Repliconchromosome [GenBank: NC_004668] [Browse all T4SS(s) in this replicon]
Location [Strand]2198027..2199049 [-]
ProductNLP/P60 family lipoprotein
Component typeOrf14_Tn
UniProt IDQ832F2
KEGG IDefa:EF2278
PDB IDNA
Domain hit(s) vs Pfam Lysozyme_like [PF13702], Evalue: 1.9e-59, Aligned region: 49..204
NLPC_P60 [PF00877], Evalue: 4e-28, Aligned region: 226..331
Protein Sequence: 340 a.a.     [Download]
>gi|29376781|ref|NP_815935.1| NLP/P60 family lipoprotein [Enterococcus faecalis V583]
MTIKKLSTVLLVLLTVLFMGILICVGLLFGDDSEGNSSTGLSSGGSNVSLEVLKHRPLVEKYAKESDILE
YVPILLAIIQVESGGTMEDVMQSSESAGFPPNSLSTEASIKQGCIYFASLVNRAKDIGCDQESIIQSYNY
GGGYLDYVGKNGKKYSFALAESFSKEKSDGEKVTYSNPIAIKENGGWRYNYGNMFYVMLVKQYLTTTKFD
DKTVQGIFDEAFKYEGTAYVFGGSSPATGFDCSGLTQWCYAKVGLQLPRVAQDQYDAMSHIELKDAKPGD
LIFFHSTYDAGTYVTHVGIYAGDNRMFHAGDPVGWTNLTETYWQQHIIGAGRYKNRKGDR
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|29374661|ref|NC_004668.1|:c2199049-2198027 Enterococcus faecalis V583 chromosome, complete genome
ATGACAATCAAAAAGTTAAGTACCGTTCTATTAGTTCTTTTAACGGTTTTGTTTATGGGAATTTTGATTT
GTGTCGGTCTATTATTTGGTGACGATAGTGAAGGAAATAGCAGTACTGGATTGTCCTCTGGAGGGAGTAA
TGTTTCCTTAGAAGTTTTAAAGCATCGTCCACTTGTAGAGAAGTATGCTAAAGAATCGGATATTTTAGAG
TATGTTCCGATTCTTCTAGCAATTATTCAGGTAGAGTCTGGCGGTACGATGGAAGATGTGATGCAAAGTT
CTGAATCAGCGGGATTCCCACCTAACTCGTTAAGCACCGAAGCTTCAATCAAGCAAGGGTGCATTTATTT
TGCTTCCTTAGTCAATCGAGCAAAGGATATCGGTTGTGATCAAGAGAGCATCATTCAATCGTATAACTAT
GGTGGTGGATATTTAGACTATGTTGGAAAAAATGGAAAGAAGTACAGCTTTGCCTTAGCGGAATCTTTTT
CAAAAGAAAAATCAGATGGGGAAAAAGTGACCTATTCGAATCCAATCGCTATTAAGGAGAATGGTGGTTG
GCGTTATAACTATGGAAATATGTTTTATGTAATGTTAGTGAAACAATATCTTACTACAACGAAGTTTGAT
GATAAAACCGTTCAAGGAATTTTTGATGAAGCTTTTAAGTATGAAGGGACGGCATATGTGTTCGGAGGTT
CAAGTCCAGCAACAGGTTTTGATTGTAGCGGATTAACGCAGTGGTGTTATGCCAAAGTTGGTTTGCAACT
TCCCAGAGTCGCGCAGGATCAGTATGATGCTATGTCTCATATCGAGTTGAAAGATGCTAAGCCAGGAGAT
TTAATTTTCTTTCACTCAACGTATGATGCAGGAACTTATGTGACACATGTAGGTATCTATGCTGGAGACA
ATCGGATGTTCCATGCAGGTGATCCCGTTGGATGGACTAATCTTACCGAAACTTATTGGCAGCAACATAT
CATTGGTGCTGGTCGGTATAAAAATAGAAAAGGGGACAGATGA
 Primer design