SecReT4
Protein ID: 29376782
T4SS name [ID]Tra_Tn [672]
Gene symbol-
Locus tagEF2279
StrainEnterococcus faecalis V583
Repliconchromosome [GenBank: NC_004668] [Browse all T4SS(s) in this replicon]
Location [Strand]2199046..2201160 [-]
Producthypothetical protein
Component typeOrf15_Tn
UniProt IDQ832F1
KEGG IDefa:EF2279
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 704 a.a.     [Download]
>gi|29376782|ref|NP_815936.1| hypothetical protein EF2279 [Enterococcus faecalis V583]
MKRKILRIVGIVLTSLFFLIILLSLVGKVAEATGLVDDTVKAGNLYSQYSLGNYQLDFFVDNSWDWLPWN
WGDGLGKSVMYGLYAITNFIWTVSLYLSNATGYVVQEAYKLDFISDTAESIGKNIQTLAGINENGLQPSG
FYFGFLMLMILVLGIYVVYTGLLKRETTKAVRAVINFVAIFLLSGSFIAYAPNYITKINDFSSDISESAL
SLGTKIVVPNSESHGKDSVDLIRDSLFSIQVQQPWLLLQFDDSNVEEIGEERVNKILSVSPDENKGKDRE
EAVKAEIEDNENANLSITKTMSRLGTVVFLVLFNIGISFFVFLLTGIMLFSQILFIIFAMFLPISFLLSM
LPTYESLGKKAIVRLFNTIMMRAGVTLVITTAFSISTMFFNISATYPFFMVAFLQIVTFAGIYFKLGDIM
SMFNLQSNDSQSMSRRVMRKPQMLMNRKFRQLNRNVGRALAFDGGVAVAGKLATDSTKENRGSKSKRLSN
RRNQSIQSNHEQNTDPKKQEKTTNSRTTRLNLMGRKAGKAMDSKSIVKDKVKQAKDHVIDTPTNLKYNLH
RGIEKAKNAPGEFKRGLVQEKKEREEQRKANHQQRQKRMDEKRQVLGNRRTSFLKRRTNVSANTFPNSKD
HSSLSQRQVAKDFHNVSVLQNRQKDSLQTIYPKIAPKMMSIKKMKNQSTLTKNGKKQYQKNSINREKVKT
GDMA
 
Nucleotide Sequence: 2115 bp     [Download]
>gi|29374661|ref|NC_004668.1|:c2201160-2199046 Enterococcus faecalis V583 chromosome, complete genome
ATGAAAAGGAAAATTTTACGGATTGTAGGCATTGTTTTGACTAGTCTATTTTTCCTCATCATTCTTTTGA
GTTTAGTTGGAAAGGTAGCGGAAGCGACTGGATTAGTCGATGATACAGTGAAAGCTGGTAATCTCTATTC
TCAATATTCTCTTGGTAACTACCAACTAGATTTTTTTGTAGACAATTCTTGGGACTGGCTACCTTGGAAC
TGGGGGGATGGTTTAGGAAAAAGCGTGATGTATGGTCTCTATGCCATCACAAATTTCATTTGGACCGTAA
GCTTGTATTTGTCGAATGCCACGGGTTATGTGGTTCAAGAAGCTTATAAATTGGATTTTATTTCAGATAC
GGCAGAAAGTATCGGGAAGAATATTCAAACTCTAGCCGGGATTAACGAAAATGGACTTCAGCCATCTGGT
TTTTATTTTGGCTTTTTGATGTTAATGATTTTGGTTTTAGGCATTTACGTAGTCTATACAGGATTACTTA
AACGGGAGACTACCAAAGCAGTGCGAGCTGTTATTAATTTTGTAGCGATTTTTCTACTTTCGGGTTCCTT
TATCGCCTATGCCCCTAACTACATTACGAAAATCAATGACTTTAGTTCGGATATTAGTGAATCTGCATTG
AGTCTTGGCACTAAGATTGTCGTACCAAATTCTGAAAGTCACGGTAAAGATAGTGTTGACTTAATTCGTG
ACAGCTTATTCTCAATTCAAGTCCAACAGCCGTGGCTCTTGTTGCAATTTGATGATTCCAATGTAGAAGA
AATTGGCGAAGAGCGAGTTAATAAAATTCTATCCGTGAGCCCGGATGAAAATAAAGGGAAGGATCGCGAG
GAGGCGGTTAAAGCCGAAATTGAAGACAATGAAAATGCAAATTTGAGTATAACAAAGACCATGAGCCGAT
TAGGGACCGTGGTTTTTTTAGTATTGTTTAATATTGGAATTTCCTTCTTTGTCTTTCTATTGACAGGAAT
AATGCTATTTTCCCAAATTCTTTTCATTATCTTTGCGATGTTTCTCCCAATTAGTTTCCTGTTGTCCATG
TTACCGACCTATGAAAGTTTGGGAAAGAAAGCGATTGTTCGCTTATTTAACACGATTATGATGCGAGCGG
GAGTGACATTGGTCATCACGACAGCATTTAGTATCTCTACGATGTTTTTCAATATTTCAGCAACCTATCC
GTTCTTTATGGTAGCATTTCTACAAATTGTAACCTTTGCCGGGATTTATTTCAAATTAGGCGACATTATG
AGTATGTTCAATCTCCAAAGTAACGATAGTCAGTCTATGAGTAGGCGTGTGATGCGAAAACCTCAAATGT
TAATGAACCGTAAATTTCGTCAACTCAATCGAAATGTTGGCCGAGCGTTGGCTTTTGATGGCGGTGTAGC
AGTTGCAGGTAAATTAGCAACTGATTCTACAAAAGAAAACAGAGGTTCAAAAAGCAAAAGATTATCTAAT
CGAAGAAACCAATCGATACAAAGTAATCATGAGCAAAATACTGATCCGAAGAAACAAGAAAAGACTACTA
ATAGTAGAACCACTCGATTGAATCTTATGGGTAGGAAAGCTGGAAAGGCAATGGATTCAAAATCTATCGT
GAAGGACAAAGTAAAACAAGCAAAAGACCATGTAATTGATACGCCAACAAATTTGAAATATAACCTGCAT
AGAGGAATTGAAAAGGCGAAAAATGCCCCAGGGGAATTTAAACGCGGGCTTGTGCAGGAGAAAAAAGAAC
GAGAAGAACAAAGAAAAGCTAATCACCAACAACGGCAGAAAAGAATGGATGAAAAACGCCAAGTGTTAGG
GAACCGGAGAACTTCTTTTTTAAAACGTCGAACTAATGTTTCAGCTAATACCTTTCCAAATTCTAAAGAT
CATTCTTCACTTAGTCAACGTCAAGTAGCAAAAGATTTCCATAATGTCTCGGTTTTACAAAATAGACAAA
AGGATTCCCTACAAACCATTTATCCTAAGATTGCACCGAAGATGATGAGTATCAAAAAAATGAAAAATCA
ATCCACTCTAACGAAAAATGGAAAGAAGCAATATCAAAAGAATTCTATAAACCGGGAGAAGGTAAAGACA
GGTGATATGGCATGA
 Primer design