SecReT4
Protein ID: 29376783
T4SS name [ID]Tra_Tn [672]
Gene symbol-
Locus tagEF2280
StrainEnterococcus faecalis V583
Repliconchromosome [GenBank: NC_004668] [Browse all T4SS(s) in this replicon]
Location [Strand]2201166..2203613 [-]
Producthypothetical protein
Component typeOrf16_Tn
UniProt IDQ832F0
KEGG IDefa:EF2280
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 9.5e-36, Aligned region: 467..762
Protein Sequence: 815 a.a.     [Download]
>gi|29376783|ref|NP_815937.1| hypothetical protein EF2280 [Enterococcus faecalis V583]
MYPIKYIENNLVFNQEGECFAYYELIPYNYSFLSPEQKYQLHDNFRQLIAQNREGKIHALQIATESSIRA
TQERSKKEVIGRLKEIALQRIDLQTDALVSMIGDSQIDYRFFIGFKLIATDEEVNLKSLKKSFFSGFQEF
IYEVNHHLMGDFVSLSNEEIRRYTKLEKLMESKLARRFKVRRVNPSDLTYLIEHIYGEKGTPFEEYAFQL
PKKKLKSETLVKRYDLLRPSRCLIEEKPRYLRIEHENHESYVTYLTINTIVGEMEFPSSELFYYQQQQFA
FPIDTSMNVEIVTNKKALAIVRNKKKELKDLDNHAYQSDNETNSNVLDALDSVDELETTLDQSKESMYKL
SYVVRVRAESVDELKRRCDEVFDFYDDTNVKLVRPFGDTMGLHEEFLPASKRYMNDYIQYVTSDFLAGLG
FGATQMLGELEGIYFGYNADTGRNVYLKPALASQGVKGSVTNALAAAFLGSLGGGKSFSNNLLVYYAVLF
GGQAVIVDPKGERGGWKENLPEIADEINILNLTSKPENQGLLDPYVIMKKKKDSESLAIDILTFLTGISS
RDGEKFPVLRKAIRTVTQSDQRGLLQVINELRKENSPVAENIADHIESFTDYDFAHLLFSDGSITQSISL
DKQLNIIQVADLVLPDAETTFEEYTTMELLSVSMLIVISTFALDFIHSNREIFKIVDLDEAWSFLQVAQG
KTLSNKLVRAGRAMNAGVYFVTQNSDDLLDERLKNNIGLKFAFRSTDIHEIKKTLEFFGLDQEDESNQKR
LRDLENGQCLMQDLYGRVGVVQVHPVFEELFHAFDTRPPVQERME
 
Nucleotide Sequence: 2448 bp     [Download]
>gi|29374661|ref|NC_004668.1|:c2203613-2201166 Enterococcus faecalis V583 chromosome, complete genome
ATGTACCCGATTAAGTATATCGAAAATAATCTTGTTTTTAATCAAGAAGGAGAGTGTTTTGCTTATTATG
AGTTAATACCTTATAACTATTCCTTCTTATCTCCTGAACAAAAATATCAATTGCATGATAATTTCCGCCA
ATTGATTGCCCAAAATCGAGAAGGTAAGATTCATGCGCTACAAATTGCGACAGAAAGTAGTATTCGTGCC
ACTCAGGAACGATCTAAAAAGGAAGTTATAGGTAGACTCAAAGAAATAGCATTACAACGGATTGATTTAC
AGACAGACGCATTAGTATCCATGATTGGCGATAGTCAGATTGATTATCGCTTTTTTATTGGTTTCAAACT
GATTGCTACAGATGAAGAAGTGAATTTGAAAAGTCTCAAAAAATCCTTCTTTTCCGGCTTTCAAGAGTTT
ATCTATGAGGTCAATCATCATTTGATGGGCGATTTTGTTTCATTATCAAATGAAGAAATTCGCCGATATA
CCAAGCTTGAAAAACTGATGGAAAGTAAATTAGCGCGGAGATTCAAAGTCAGACGAGTGAATCCCAGTGA
TCTTACTTACTTGATTGAACATATTTATGGCGAAAAAGGTACACCGTTTGAAGAATACGCCTTTCAGTTA
CCAAAGAAAAAATTGAAATCAGAAACTTTGGTGAAACGCTATGACTTATTACGTCCCAGTCGTTGTTTGA
TTGAAGAGAAACCTCGTTACTTAAGGATTGAACATGAGAATCATGAGTCTTATGTAACCTATTTGACAAT
TAATACCATTGTCGGGGAGATGGAGTTTCCTTCCTCAGAGCTTTTCTATTACCAGCAACAACAATTTGCT
TTTCCGATTGATACTTCAATGAATGTAGAAATTGTCACCAATAAAAAGGCATTAGCTATCGTTCGCAACA
AGAAAAAGGAATTAAAAGATTTAGACAACCACGCTTACCAATCTGACAATGAAACGAATTCCAATGTTTT
GGATGCTTTGGATTCCGTTGATGAATTGGAGACCACCTTGGATCAGTCAAAAGAATCCATGTACAAATTG
AGCTATGTGGTCCGGGTGAGAGCAGAATCAGTGGATGAACTAAAACGCCGTTGTGATGAAGTGTTCGATT
TTTATGATGATACCAATGTGAAACTAGTCCGGCCCTTTGGCGATACGATGGGGCTACATGAAGAATTCCT
ACCAGCTAGTAAACGGTATATGAATGACTATATCCAGTATGTAACATCTGACTTTTTAGCAGGACTTGGC
TTTGGCGCCACTCAAATGTTAGGAGAGTTGGAAGGGATTTACTTTGGCTACAATGCGGATACGGGGCGTA
ATGTTTACCTGAAACCCGCATTAGCCTCACAAGGAGTAAAGGGCTCAGTAACCAATGCATTAGCTGCGGC
TTTTCTTGGTTCTCTTGGTGGCGGAAAATCCTTTAGTAACAATCTCTTGGTCTACTATGCTGTTCTTTTT
GGTGGCCAAGCTGTGATTGTCGATCCAAAAGGAGAACGAGGTGGTTGGAAAGAAAACTTGCCAGAAATTG
CGGATGAAATCAATATTCTCAACTTGACTAGTAAACCAGAAAATCAAGGCTTACTTGATCCTTATGTGAT
TATGAAGAAAAAGAAAGATTCAGAAAGTTTAGCAATTGATATCCTGACTTTTTTAACAGGAATTTCCAGT
CGGGATGGGGAGAAGTTTCCAGTATTGCGCAAAGCCATTCGGACGGTTACCCAAAGTGATCAACGAGGAT
TGCTGCAAGTCATTAATGAGCTTCGAAAGGAGAACTCTCCAGTCGCGGAAAATATCGCCGATCATATCGA
GTCCTTTACCGATTATGATTTTGCCCATTTGCTTTTCTCAGATGGTTCGATTACCCAATCAATTAGTTTA
GATAAGCAGTTGAATATCATTCAAGTAGCGGATTTGGTTTTACCAGATGCAGAAACCACTTTTGAAGAAT
ATACCACGATGGAGTTGCTAAGTGTCTCTATGCTAATCGTCATTTCCACGTTTGCCTTGGATTTTATCCA
TAGTAATCGAGAAATCTTCAAGATTGTGGACCTGGATGAGGCTTGGAGTTTTCTTCAAGTGGCTCAAGGA
AAGACCCTTTCAAATAAGCTCGTTCGTGCTGGTCGGGCCATGAATGCCGGTGTTTACTTTGTCACGCAAA
ATAGTGACGATTTACTGGATGAACGCTTGAAGAATAATATCGGATTGAAATTTGCTTTTCGTAGTACCGA
TATTCATGAAATCAAGAAGACTTTGGAATTTTTTGGGTTGGATCAAGAAGATGAAAGTAATCAAAAACGC
CTACGAGATTTGGAAAACGGCCAATGCTTGATGCAGGATTTGTATGGTCGGGTAGGTGTGGTTCAGGTTC
ACCCGGTCTTTGAAGAACTCTTCCATGCCTTTGATACTCGCCCACCGGTTCAAGAGAGAATGGAGTGA
 Primer design