SecReT4
Protein ID: 29376784
T4SS name [ID]Tra_Tn [672]
Gene symbol-
Locus tagEF2281
StrainEnterococcus faecalis V583
Repliconchromosome [GenBank: NC_004668] [Browse all T4SS(s) in this replicon]
Location [Strand]2203600..2203989 [-]
Producthypothetical protein
Component typeOrf17_Tn
UniProt IDQ832E9
KEGG IDefa:EF2281
PDB IDNA
Domain hit(s) vs Pfam TcpE [PF12648], Evalue: 1.7e-33, Aligned region: 6..107
Protein Sequence: 129 a.a.     [Download]
>gi|29376784|ref|NP_815938.1| hypothetical protein EF2281 [Enterococcus faecalis V583]
MKKIKSYTSIWAVEKVIYAINDFQLPFPVTFNQMAWFVLSLLFVIVFAHVPPLSVIEGAFLKYFGIPVAI
TWFMSQKTFDGKKPLGFLRSFISYHLRFKVTFAGKKVKEQKKRWDEPITLVRSVNYVPD
 
Nucleotide Sequence: 390 bp     [Download]
>gi|29374661|ref|NC_004668.1|:c2203989-2203600 Enterococcus faecalis V583 chromosome, complete genome
ATGAAAAAAATAAAAAGCTACACCAGTATCTGGGCAGTTGAAAAAGTCATTTACGCAATCAATGACTTTC
AGCTGCCTTTTCCTGTAACTTTTAACCAAATGGCTTGGTTTGTTTTATCCTTGCTGTTTGTCATTGTATT
TGCCCATGTGCCTCCACTATCTGTGATAGAGGGGGCATTTTTAAAATACTTTGGCATCCCGGTGGCGATT
ACTTGGTTTATGTCGCAAAAGACTTTTGATGGCAAGAAACCATTGGGATTTTTACGATCCTTTATCAGTT
ATCATTTACGATTTAAGGTCACTTTTGCAGGAAAAAAAGTTAAAGAACAGAAAAAACGATGGGATGAACC
CATTACCTTAGTGAGGAGTGTGAACTATGTACCCGATTAA
 Primer design