SecReT4
Protein ID: 29376837
T4SS name [ID]Tra_Tn [672]
Gene symbol-
Locus tagEF2336
StrainEnterococcus faecalis V583
Repliconchromosome [GenBank: NC_004668] [Browse all T4SS(s) in this replicon]
Location [Strand]2259509..2259730 [-]
Producthypothetical protein
Component typeOrf19_Tn
UniProt IDQ81ZJ6
KEGG IDefa:EF1883, efa:EF2336
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 73 a.a.     [Download]
>gi|29376837|ref|NP_815991.1| hypothetical protein EF2336 [Enterococcus faecalis V583]
MNFGQNLYQWFLTNAQSLVLLAIVVIGLFLGFKREFSKLIGFLVIALIAVGLVFNASGVKDVLLNLFNRI
VGA
 
Nucleotide Sequence: 222 bp     [Download]
>gi|29374661|ref|NC_004668.1|:c2259730-2259509 Enterococcus faecalis V583 chromosome, complete genome
ATGAATTTTGGACAAAATTTATATCAATGGTTTTTGACCAATGCTCAATCCTTAGTCTTACTAGCGATTG
TAGTCATTGGTTTATTTTTAGGATTTAAGCGGGAGTTTTCTAAATTAATTGGCTTTTTGGTGATTGCCTT
GATTGCGGTAGGTTTGGTCTTTAATGCTTCTGGTGTGAAGGATGTCTTACTCAATTTATTTAACCGAATT
GTTGGTGCATAA
 Primer design