SecReT4
Protein ID: 29376844
T4SS name [ID]Tra_Tn [672]
Gene symbol-
Locus tagEF2343
StrainEnterococcus faecalis V583
Repliconchromosome [GenBank: NC_004668] [Browse all T4SS(s) in this replicon]
Location [Strand]2264189..2265535 [-]
ProductFtsK/SpoIIIE family protein
Component typeOrf21_Tn
UniProt IDQ820T9
KEGG IDefa:EF2343
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 1.6e-31, Aligned region: 188..365
AAA_10 [PF12846], Evalue: 1e-06, Aligned region: 222..259
DUF87 [PF01935], Evalue: 3.9e-06, Aligned region: 222..330
Protein Sequence: 448 a.a.     [Download]
>gi|29376844|ref|NP_815998.1| FtsK/SpoIIIE family protein [Enterococcus faecalis V583]
MYKGHRIRARNQHLIYHFVLGWLLALFIGCMSVFYFQELRQFEISKLSFSTSEIDWSTKDLICLLGSFAL
SGGMILLYIHFFQDHWRSLWHRQKLARMILENHWYEVKQTQSEGFFKDLNGSRTKESISYFPKIYYRMKD
GLLSIRVQISLGKYQDQLLKLEKKLESGLYCELVEKELKDSYVDYTLLYDMIANRIGIEEAVVENGALRL
MKNQVWAYDFLPHMLIAGGTGGGKTYFLLTIIEALLKSDAELFILDPKNADLADLGTIMTHVYSQKEQIS
ACVEDFYERMMVRSRLMKEMPNYKTGENYAYLGLSPNFLVFDEYVAYMEMLTTKESAVILNKLKQIVMLG
RQSGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSELGYSMMFGEVDKIFFMKQIKGRGYVDTGGGVV
SEFYTPLVPKGYDFLESTKTIVQNNINI
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|29374661|ref|NC_004668.1|:c2265535-2264189 Enterococcus faecalis V583 chromosome, complete genome
ATGTACAAAGGACATCGCATACGCGCAAGAAATCAGCATTTAATTTATCACTTTGTTCTTGGCTGGCTAC
TTGCTTTGTTCATTGGTTGTATGAGCGTCTTTTATTTTCAAGAGCTTAGACAATTTGAGATTTCTAAGCT
ATCATTCTCCACTAGTGAAATTGATTGGTCCACGAAAGATTTAATCTGTTTACTAGGAAGTTTTGCTCTT
TCAGGAGGTATGATATTGCTTTATATTCACTTTTTTCAGGATCATTGGCGCAGTTTATGGCATCGACAAA
AGCTAGCTCGGATGATTCTAGAAAACCATTGGTATGAAGTGAAACAAACTCAAAGTGAAGGTTTTTTCAA
AGATTTGAATGGTAGTCGGACCAAAGAAAGTATCAGTTACTTCCCCAAAATTTATTATCGAATGAAGGAT
GGCTTACTTTCTATTCGCGTTCAAATTTCACTGGGAAAATATCAAGATCAACTATTAAAGCTAGAAAAGA
AGTTAGAAAGCGGACTGTATTGTGAGTTAGTAGAAAAGGAACTCAAAGACTCCTATGTGGATTATACCTT
GCTTTACGATATGATTGCCAATCGAATTGGGATAGAAGAAGCAGTGGTAGAAAATGGAGCTTTGCGATTG
ATGAAAAATCAAGTATGGGCGTATGATTTCTTGCCTCATATGTTAATCGCAGGTGGTACAGGTGGTGGGA
AGACTTACTTTTTACTCACCATCATCGAGGCTTTACTGAAATCTGATGCAGAACTATTTATCCTTGATCC
CAAAAATGCGGATCTAGCAGATTTAGGCACAATAATGACTCACGTATATTCCCAAAAAGAACAAATTTCC
GCTTGTGTAGAAGATTTCTATGAACGTATGATGGTTCGTAGTAGGTTGATGAAAGAAATGCCAAACTACA
AAACAGGAGAGAATTATGCGTATCTTGGTCTTTCACCAAATTTTTTAGTTTTTGATGAATATGTGGCTTA
TATGGAGATGTTAACGACTAAGGAAAGCGCGGTAATTTTGAATAAGCTCAAACAAATCGTCATGTTAGGT
CGGCAGTCCGGTTTCTTTCTGATTCTGGCTTGTCAAAGACCGGATGCGAAATATTTAGGAGACGGAATAC
GGGATCAATTCAACTTCCGTGTGGCTTTGGGTCGTATGAGTGAACTGGGGTATTCTATGATGTTTGGTGA
GGTTGATAAAATTTTTTTTATGAAACAAATCAAGGGGCGAGGCTATGTAGATACAGGTGGGGGTGTTGTT
AGTGAGTTTTACACGCCTTTAGTTCCGAAGGGGTATGATTTTTTGGAATCTACCAAAACCATTGTGCAAA
ATAATATAAATATCTAA
 Primer design