SecReT4
Protein ID: 29377909
T4SS name [ID]Prg/Pcf [614]
Gene symbol-
Locus tagEF_B0015
StrainEnterococcus faecalis V583
Repliconplasmid pTEF2 [GenBank: NC_004671] [Browse all T4SS(s) in this replicon]
Location [Strand]16622..16849 [+]
Producthypothetical protein
Component typePrgF
UniProt IDQ82YM7
KEGG IDefa:EF_B0015
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 75 a.a.     [Download]
>gi|29377909|ref|NP_817035.1| hypothetical protein EF_B0015 [Enterococcus faecalis V583]
MDIVTKIITLIGGIIGLVSAVSIMFGVKEIRSGMSNDDPRTLDKGIEKVVVGGAVILAIGGVVAYVITQV
GAIRF
 
Nucleotide Sequence: 228 bp     [Download]
>gi|29377895|ref|NC_004671.1|:16622-16849 Enterococcus faecalis V583 plasmid pTEF2, complete sequence
ATGGATATAGTCACAAAAATTATTACACTAATTGGAGGAATCATTGGACTTGTTTCAGCAGTTAGTATTA
TGTTTGGCGTGAAAGAAATTCGTTCAGGTATGTCGAATGATGATCCACGTACGCTTGATAAAGGAATAGA
AAAAGTAGTTGTTGGTGGGGCTGTTATTTTAGCAATTGGTGGGGTAGTCGCCTATGTTATTACACAGGTA
GGAGCTATTCGTTTTTAA
 Primer design