SecReT4
Protein ID: 29377913
T4SS name [ID]Prg/Pcf [614]
Gene symbol-
Locus tagEF_B0019
StrainEnterococcus faecalis V583
Repliconplasmid pTEF2 [GenBank: NC_004671] [Browse all T4SS(s) in this replicon]
Location [Strand]18436..20673 [+]
Producthypothetical protein
Component typePrgJ
UniProt IDQ82YM3
KEGG IDefa:EF_B0019
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.3e-39, Aligned region: 408..702
DUF87 [PF01935], Evalue: 2.2e-05, Aligned region: 399..470
Protein Sequence: 745 a.a.     [Download]
>gi|29377913|ref|NP_817039.1| hypothetical protein EF_B0019 [Enterococcus faecalis V583]
MHIVEDEFSKCYKLGEVDYEIAVEEDQLNTVMGYAEGLNTLDKKSRYQLLVVNKREEESLMEDVLLAYQG
DHLDNYRQEINEIITKQYEQDERNFKIEKYAIFTTKSSSMKQANKELEGIMQNFANRFEANQIKLEVTPM
TGLERLSLFSYFLRHGQYFGTSYQDIAVSGLTSKAFIVPSKIKFPNNKAYFRLGENYAAVLTIQQYPKYL
EDKLIKELCATGRELAISIHARPYDMMEARKAIQGTKTLNDVAIQKQQKQNFRSGVSEDAISGEAKEIQE
TTNALMDEIKNNGQKLFNGLFSVFLIAETEKELLEAVESVKNVGATWQVVFDTVDNYKEEALNTILPIGK
PYLDVEMSYMRDLTTTNIATQVPFTNVELQSPTGQFYGRNQLTKNMITIDRKKDLITPSGLIFGTSGSGK
GMATKWEILSTRLKFPKDRFLIVDPESEYLPIGKELDAEILDISTGTKNHLNILGMVDKQLLDEEDQELD
LVKEKSNLLSTMFESLLKSYTDVDAGLVDRVTLLTYERFENKETEPTLVDWFRILKEQTDEGAKELANKV
ETYCVGSQDIFAHQTNIDLTAPFIVFNTKKLDDRLKKFAMKVILDQLWKQVVSGQGKVTSRLYFDELQVN
FTTEEEAEWFLNLWARIRKYGAVTTGITQNPTTLLDSKAGQKMIANSEFLILLRQKPIDSQRLVEILSLT
PALKKYINDRAPQGTGLISAGGVVVPFENPIPKETHLFEIMNTDA
 
Nucleotide Sequence: 2238 bp     [Download]
>gi|29377895|ref|NC_004671.1|:18436-20673 Enterococcus faecalis V583 plasmid pTEF2, complete sequence
ATGCACATTGTAGAGGATGAGTTTTCTAAATGCTATAAACTTGGAGAAGTGGACTACGAAATTGCTGTAG
AAGAAGATCAATTAAACACGGTAATGGGGTATGCAGAAGGGTTAAATACACTAGACAAAAAATCTCGGTA
TCAGCTGCTGGTTGTTAATAAAAGAGAAGAAGAGTCGTTGATGGAAGACGTTTTATTGGCGTATCAGGGA
GATCACTTAGATAACTACCGTCAAGAAATCAATGAAATTATAACGAAGCAGTATGAACAAGACGAACGAA
ACTTTAAGATTGAAAAATATGCTATTTTCACCACAAAAAGTTCGTCCATGAAACAAGCTAACAAAGAGTT
AGAAGGAATCATGCAGAACTTTGCCAATCGTTTTGAAGCCAACCAAATTAAATTAGAGGTAACCCCAATG
ACTGGCTTAGAGCGATTGTCTTTGTTCAGCTATTTTTTGCGCCACGGACAATATTTTGGCACAAGCTATC
AAGATATTGCCGTATCAGGGCTAACGTCTAAAGCGTTTATTGTTCCAAGTAAAATCAAGTTTCCAAACAA
TAAAGCTTATTTTCGGTTAGGAGAAAACTACGCAGCTGTTTTAACCATTCAACAATACCCAAAATACCTA
GAAGATAAGTTAATCAAAGAATTATGCGCTACAGGAAGAGAGTTAGCGATTAGCATTCATGCCAGACCTT
ATGACATGATGGAAGCCAGAAAGGCAATACAGGGAACCAAGACGTTAAATGATGTTGCCATTCAAAAGCA
ACAGAAGCAAAACTTCAGAAGTGGTGTTTCAGAGGATGCGATTTCAGGAGAAGCAAAGGAAATCCAAGAA
ACAACGAACGCGTTAATGGATGAAATAAAAAATAATGGCCAAAAGTTATTTAATGGCCTATTTTCAGTTT
TCCTAATTGCAGAAACAGAAAAGGAACTTTTAGAAGCTGTTGAATCGGTGAAAAACGTAGGAGCAACCTG
GCAAGTTGTGTTTGATACGGTAGACAATTACAAAGAAGAAGCACTCAATACTATCTTACCGATTGGAAAA
CCTTACTTAGACGTTGAAATGAGTTATATGCGTGATCTAACAACAACAAATATTGCTACACAAGTACCTT
TTACCAATGTGGAATTACAAAGCCCAACAGGTCAGTTTTATGGCCGGAATCAGTTGACGAAGAACATGAT
TACTATTGACCGAAAAAAAGATTTAATTACACCAAGTGGGCTTATTTTCGGAACGTCTGGTTCTGGTAAA
GGAATGGCGACCAAATGGGAAATTCTTTCAACGCGTTTAAAATTTCCGAAGGATCGCTTTTTAATTGTTG
ATCCAGAAAGTGAATACTTACCGATTGGGAAAGAATTGGATGCAGAAATACTCGATATCTCAACTGGTAC
GAAAAACCACTTGAATATTTTAGGAATGGTAGACAAGCAGTTATTGGATGAAGAGGACCAGGAACTTGAT
TTAGTTAAAGAAAAATCTAATTTGTTATCCACTATGTTTGAATCGCTACTAAAAAGCTATACGGACGTGG
ATGCGGGACTTGTTGATCGTGTGACGTTGTTGACGTATGAACGCTTTGAAAACAAAGAGACAGAGCCAAC
ATTAGTCGATTGGTTTAGAATCTTAAAAGAACAAACGGATGAAGGTGCCAAAGAATTAGCGAATAAAGTG
GAAACCTATTGTGTGGGTTCACAAGATATCTTTGCGCACCAAACGAATATCGACTTAACGGCACCCTTTA
TTGTCTTTAATACAAAAAAATTAGATGATCGCTTGAAAAAGTTTGCCATGAAAGTGATTTTAGATCAGTT
GTGGAAACAAGTAGTATCCGGACAAGGAAAAGTAACGTCACGTTTGTATTTTGATGAATTACAAGTCAAT
TTCACAACGGAAGAAGAAGCAGAATGGTTCTTAAATTTATGGGCGCGTATTCGTAAGTATGGCGCCGTGA
CAACAGGTATCACGCAAAACCCTACGACGTTATTAGACAGTAAAGCGGGGCAAAAAATGATTGCCAATAG
TGAATTTTTGATTTTATTACGGCAAAAACCAATTGATTCACAACGATTAGTAGAAATTTTAAGTCTGACA
CCTGCATTGAAGAAGTATATCAATGATCGAGCCCCACAAGGAACGGGGCTAATTTCTGCAGGTGGGGTAG
TTGTTCCGTTTGAAAATCCTATTCCAAAAGAAACACATCTATTTGAAATTATGAATACCGACGCTTAG
 Primer design