SecReT4
Protein ID: 29377914
T4SS name [ID]Prg/Pcf [614]
Gene symbol-
Locus tagEF_B0020
StrainEnterococcus faecalis V583
Repliconplasmid pTEF2 [GenBank: NC_004671] [Browse all T4SS(s) in this replicon]
Location [Strand]20685..23300 [+]
Producthypothetical protein
Component typePrgK
UniProt IDQ82YM2
KEGG IDefa:EF_B0020
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 2e-25, Aligned region: 758..862
Protein Sequence: 871 a.a.     [Download]
>gi|29377914|ref|NP_817040.1| hypothetical protein EF_B0020 [Enterococcus faecalis V583]
MVESKRTWKEKVHVESQVEERLRKNLTLKSREATKLQKKALKTTKKEFKLSKKNYKQSLKKHKLTLKTGK
EPLSINHLLDKKKFVEQKKRKKAQKIAYKRTKKVDETRVVNQVKRETKEGLKREATQKVRTTLTQEDTLN
EAMTLYEKTQQAKFNMRTALKTGKTVKNLSVKTAKDTYGLGNRLFNFSRGRGFQRTPKDFTLKKQLMKQL
RNRAMRFKAAKEAKKAEQGIGLIRSFFNGQKTLGKVAALILKNPISWVVLLVLFLVFLLSGVASSTQKPA
IVQEEEDLTASWTYFTKLDAQHTDDNNLFYSNIDDVLFYMNYRYDDFKLLDMDSTGTKNFETILSELWTA
LNGKKPDYQLKTMQSLETDKKSSYFIEEEQAKHYQEIKKELGYQTLDDLLSFPVKTDALIVNKRYGYDKS
KEKLTLYKGIDVLIEDNQPFHSPMNGQIVSVPDTETLVIEKEKVARLTIRGVNTLRLTKGMDVEEGTFLG
NTKNSTVTFQYEKYKKETKDWFFVNPAFYFPRVTYTQTTLLGSAEFSPGASVEKRAQAVYDYLSKKGYTK
EGISAILGNFSVESGINPKRAEGDYLNPPVGAHGNSWDEPSWLAMGGPQIYGGRFPNILHRGLGLGQWTD
TADGGRRHTLLLDYAKGKNKKWYDLQLQLDFIFDGDAPGSRTAADNVARSKVAATIPELTTYYLTVWEGN
PGDKLGERIQAAQNWFTFFSRSGTPIGGSGSEVFAQYKEKMQPLPTDRETKAGQGWPGNAYAPGNCTWYV
FNRFAQLGKSIYPTMGNANQWVHNYSQTPGATLESAPKKGDAVIFTNGVAGSSTQYGHVAYVEHVNSDGS
FVISEMNVSGEYSMNWRVLKKEAGEYFMRLN
 
Nucleotide Sequence: 2616 bp     [Download]
>gi|29377895|ref|NC_004671.1|:20685-23300 Enterococcus faecalis V583 plasmid pTEF2, complete sequence
ATGGTAGAAAGTAAGCGTACTTGGAAAGAAAAAGTACATGTTGAATCTCAAGTAGAAGAGCGTCTTAGAA
AAAATTTGACCTTAAAATCAAGAGAAGCGACGAAGTTGCAAAAAAAAGCATTAAAGACGACTAAAAAGGA
GTTTAAACTTTCTAAGAAAAATTACAAGCAATCACTAAAAAAACATAAACTTACCTTGAAAACAGGGAAG
GAACCATTAAGTATTAACCATTTACTGGATAAAAAGAAATTTGTAGAGCAAAAGAAACGCAAAAAAGCAC
AGAAAATTGCTTACAAACGAACGAAAAAAGTAGATGAAACGCGTGTCGTTAACCAAGTGAAAAGGGAAAC
CAAGGAAGGGTTGAAAAGAGAAGCGACGCAAAAAGTACGAACCACGTTAACGCAGGAAGATACACTGAAT
GAAGCAATGACCCTTTATGAAAAAACACAACAAGCTAAATTTAACATGCGTACAGCTTTGAAAACAGGAA
AAACGGTTAAGAATCTTTCGGTGAAAACTGCAAAAGATACGTACGGATTGGGGAATCGCTTATTTAACTT
TTCAAGAGGACGTGGGTTTCAGCGCACACCAAAAGACTTTACGTTAAAAAAACAACTTATGAAACAACTA
CGGAATCGCGCTATGCGCTTTAAAGCAGCAAAAGAAGCGAAGAAAGCCGAACAAGGTATTGGCTTGATTC
GTTCTTTTTTTAATGGTCAGAAGACATTAGGGAAAGTCGCTGCATTGATTCTAAAAAATCCAATTTCTTG
GGTTGTTTTATTGGTTCTTTTTCTTGTTTTTTTATTGAGTGGCGTTGCAAGTAGTACACAAAAACCAGCG
ATTGTTCAAGAAGAGGAAGATTTAACCGCTTCATGGACGTATTTTACTAAATTAGATGCGCAACATACAG
ACGATAACAACCTGTTTTATAGCAATATCGATGATGTTCTTTTCTACATGAATTATCGGTACGATGATTT
TAAATTATTAGATATGGATTCCACTGGTACAAAGAATTTTGAAACGATTCTATCTGAACTTTGGACGGCA
CTAAACGGAAAGAAACCTGATTATCAGTTGAAAACAATGCAAAGTTTAGAGACAGATAAGAAATCGAGTT
ATTTTATCGAAGAGGAACAAGCAAAGCATTATCAAGAGATAAAAAAAGAGTTAGGCTACCAAACATTGGA
TGATCTCCTTTCTTTTCCAGTAAAAACTGACGCTTTAATTGTCAATAAGCGTTATGGCTATGACAAATCA
AAAGAGAAGCTCACCTTATATAAAGGCATTGATGTATTGATTGAAGATAATCAGCCGTTTCATTCACCAA
TGAACGGCCAAATCGTTTCAGTGCCTGATACAGAAACGCTGGTTATCGAAAAAGAGAAAGTAGCTAGGTT
AACGATTCGTGGTGTGAATACCCTTCGACTAACAAAAGGTATGGATGTTGAAGAAGGAACATTTCTTGGG
AATACAAAGAATTCAACAGTTACGTTCCAATATGAAAAATATAAAAAAGAAACGAAAGACTGGTTTTTTG
TAAATCCAGCCTTTTATTTTCCACGTGTAACCTACACGCAAACGACTCTTTTAGGAAGTGCAGAATTTTC
TCCTGGAGCAAGTGTCGAAAAAAGAGCGCAAGCTGTTTATGATTATTTATCAAAAAAGGGATACACCAAA
GAGGGAATTAGCGCGATTTTAGGCAATTTTTCGGTAGAAAGTGGCATTAATCCAAAACGTGCAGAAGGGG
ATTATTTGAATCCGCCTGTAGGTGCGCATGGGAATTCATGGGACGAACCGAGTTGGCTTGCTATGGGAGG
ACCGCAAATTTATGGAGGACGTTTTCCAAATATTCTCCATCGAGGACTAGGTTTAGGTCAGTGGACGGAT
ACAGCTGATGGTGGTCGTAGGCATACTTTGTTATTAGACTATGCCAAAGGTAAAAATAAAAAATGGTACG
ATCTGCAATTGCAACTGGACTTTATTTTTGACGGCGATGCACCAGGTTCACGAACAGCAGCAGACAATGT
AGCAAGAAGTAAGGTGGCTGCAACTATTCCAGAACTTACTACTTATTATCTAACTGTTTGGGAAGGAAAT
CCCGGAGACAAGTTAGGAGAACGAATTCAAGCTGCACAAAATTGGTTTACATTCTTTTCTCGATCGGGTA
CACCAATCGGTGGTTCTGGGAGTGAGGTCTTTGCGCAGTATAAAGAAAAAATGCAACCATTACCCACAGA
CAGAGAAACAAAAGCAGGACAAGGCTGGCCAGGCAATGCGTATGCGCCAGGGAATTGTACTTGGTATGTG
TTTAATCGTTTTGCACAGTTAGGAAAAAGCATTTACCCTACTATGGGAAACGCCAATCAATGGGTGCATA
ACTACAGTCAAACGCCCGGAGCGACACTTGAATCGGCCCCTAAAAAAGGGGATGCTGTTATTTTTACAAA
TGGTGTAGCTGGTTCTAGTACGCAATATGGACACGTGGCTTATGTGGAGCATGTAAACTCTGATGGTAGT
TTTGTCATTTCTGAAATGAATGTCAGTGGTGAGTATTCTATGAATTGGCGTGTCTTAAAAAAAGAAGCAG
GCGAATACTTTATGCGCCTAAACTAA
 Primer design