SecReT4
Protein ID: 29377915
T4SS name [ID]Prg/Pcf [614]
Gene symbol-
Locus tagEF_B0021
StrainEnterococcus faecalis V583
Repliconplasmid pTEF2 [GenBank: NC_004671] [Browse all T4SS(s) in this replicon]
Location [Strand]23324..23950 [+]
Producthypothetical protein
Component typePrgL
UniProt IDQ82YM1
KEGG IDefa:EF_B0021
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 208 a.a.     [Download]
>gi|29377915|ref|NP_817041.1| hypothetical protein EF_B0021 [Enterococcus faecalis V583]
MYNMEKLSRYKKIGFIGGSLLLIVLIFLIGLSVGQRKQVNTNEKQVKVEKKEELTTSTVKKFLIAYYTKK
DLGENRNRYEPLVTSAMYNELVNVEKQPVNQAYKGYVVNQVLDTYKIYIDTENNEVIVDVTYKNTQRTKR
NNDEGALKNQSNQEAMKLTFVKQGANFLVDKMAPVTLTNELQEEPNSYNTHVVTTEESTKESANSGEK
 
Nucleotide Sequence: 627 bp     [Download]
>gi|29377895|ref|NC_004671.1|:23324-23950 Enterococcus faecalis V583 plasmid pTEF2, complete sequence
ATGTATAATATGGAAAAATTAAGTAGATACAAGAAAATTGGCTTTATTGGTGGCAGCTTACTGCTTATTG
TGCTTATTTTTTTGATTGGGCTTAGTGTTGGGCAAAGAAAACAAGTAAACACCAATGAAAAACAAGTAAA
AGTCGAGAAAAAAGAGGAATTAACAACAAGTACGGTAAAAAAATTTTTGATTGCGTATTATACAAAAAAA
GATCTTGGTGAAAATAGAAATCGCTATGAACCTTTGGTGACAAGCGCCATGTATAACGAATTAGTGAATG
TAGAAAAACAGCCTGTTAATCAAGCGTATAAAGGCTATGTAGTCAATCAAGTACTTGATACGTATAAAAT
CTATATTGATACTGAAAACAATGAAGTCATTGTGGACGTCACGTATAAGAATACACAACGAACCAAACGA
AATAATGATGAAGGAGCGTTGAAAAATCAGAGCAATCAAGAAGCGATGAAATTAACCTTTGTAAAACAAG
GCGCTAATTTTTTAGTGGATAAAATGGCACCAGTAACACTTACCAATGAATTACAAGAGGAGCCAAATTC
TTATAATACACATGTAGTAACGACAGAAGAATCAACAAAGGAGAGTGCAAACAGTGGGGAAAAGTAA
 Primer design