SecReT4
Protein ID: 294010443
T4SS name [ID]VirB [28]
Gene symbolvirD4
Locus tagSJA_C1-04570
StrainSphingobium japonicum UT26S
Repliconchromosome 1 [GenBank: NC_014006] [Browse all T4SS(s) in this replicon]
Location [Strand]465718..467682 [-]
Producttype IV secretory pathway VirD4 component
Component typeVirD4
UniProt IDD4YY59
KEGG IDsjp:SJA_C1-04570
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2e-103, Aligned region: 114..540
TraG-D_C [PF12696], Evalue: 2.1e-26, Aligned region: 382..503
TrwB_AAD_bind [PF10412], Evalue: 1.8e-23, Aligned region: 179..512
Protein Sequence: 654 a.a.     [Download]
>gi|294010443|ref|YP_003543903.1| type IV secretory pathway VirD4 component [Sphingobium japonicum UT26S]
MPVQRSFWMIGLSVAGGTLLCCAIAVLVALFGLGQIGSHTDLTALPAWLWYYRTDPLLILWLKRGALAGA
VVVGLLAIGILRRGPALHGTARFAREGEIRREGLRAASGIVVGRKAGRFLIFGGSEHVLLEAPTRAGKGV
GVVIPNLLTWPDSVVVLDVKRENWGASAGYRARAGQAVHLFDPLDAEGRTARYNPLAHIRRTDDIEVVNE
LQKIAGMLFPAPERSDPFWAEAARAAFVGVGALVASNPGLPFTIGEIYRRLTSGDPKSDLPATLQEARRV
GQRLSQACVSAIQDFTSASDNTFSGIKQTITARLNLWLNPMVDAATSESDFDLREVRRRRMSIYLGVSPD
NIDRIAPIYSLFLQQLVDLNTRDLPEGATNVPVLVLLDEFARLGKASVIASGFSYVAGYGLRLVPVIQSR
SQLRAIYGPDVTDEIIANCGLEVVFTPKELKVANELSERLGFFTMSVKSRSRTIHGLLANRSISESDQRR
ALLLPQELMQLPKSELLLLRAGIPPIRGRKIAYYRMPRFTRRVIAPPVLPARPIAAMLSSPTPALEQHGA
GTPGLSGTRRQPATSSGNAIPEEIAMREMTEAELSGAAEITDDMLVLGDLAELPPPGDEAAAIAFVTAMV
ERAVLPPTGSASTSLMQERAAHVR
 
Nucleotide Sequence: 1965 bp     [Download]
>gi|294009986|ref|NC_014006.1|:c467682-465718 Sphingobium japonicum UT26S chromosome 1, complete genome
ATGCCGGTGCAGCGTAGCTTCTGGATGATCGGCCTGTCCGTTGCCGGCGGCACCTTATTGTGCTGCGCCA
TCGCCGTGCTGGTTGCCCTCTTTGGGCTGGGCCAGATCGGCTCTCACACCGACCTCACGGCCTTGCCCGC
ATGGCTGTGGTACTATCGGACGGACCCACTGCTTATTCTTTGGCTAAAGCGCGGGGCGCTGGCGGGCGCA
GTTGTGGTTGGGCTCCTCGCGATTGGGATTCTGCGCCGCGGGCCGGCATTGCACGGCACCGCCCGGTTTG
CGCGCGAAGGCGAGATCCGGCGGGAGGGCCTTCGCGCCGCGTCCGGCATCGTTGTCGGCCGCAAGGCTGG
ACGTTTCCTGATATTCGGCGGGAGCGAGCATGTTCTGCTCGAGGCACCCACACGAGCGGGCAAGGGCGTG
GGCGTCGTCATTCCCAATCTGCTGACCTGGCCAGATTCGGTGGTCGTGCTCGACGTGAAACGGGAGAACT
GGGGCGCAAGCGCCGGCTATCGTGCACGGGCCGGCCAGGCCGTGCATCTGTTCGATCCGCTCGACGCGGA
GGGGCGGACGGCGCGGTACAACCCCCTGGCGCACATCAGACGGACTGATGACATAGAGGTCGTCAACGAG
CTGCAGAAGATCGCGGGCATGCTTTTCCCCGCGCCCGAGCGATCCGATCCCTTCTGGGCGGAGGCCGCGC
GAGCGGCCTTTGTCGGCGTCGGCGCCCTGGTCGCATCCAACCCGGGCCTGCCCTTCACCATCGGCGAGAT
ATACCGCCGCCTCACGAGCGGGGATCCCAAGAGCGACCTTCCCGCAACGCTTCAGGAAGCCCGCAGGGTG
GGCCAGCGCCTCAGCCAAGCGTGCGTGTCCGCGATCCAGGATTTCACCTCGGCCTCGGACAACACCTTTT
CCGGGATCAAGCAGACCATCACCGCGCGGCTCAATCTCTGGCTCAACCCCATGGTGGATGCCGCCACCTC
GGAAAGCGACTTCGACCTGCGCGAGGTACGGCGTCGGCGCATGTCGATTTACCTTGGCGTGTCGCCCGAC
AATATCGACCGCATCGCGCCGATCTACAGCCTGTTCCTGCAGCAACTCGTGGATCTCAACACCCGCGATC
TTCCTGAGGGCGCGACCAATGTCCCGGTCCTGGTCCTGCTCGACGAGTTCGCCAGGCTCGGCAAAGCCTC
GGTGATTGCGAGCGGCTTTTCCTATGTCGCCGGCTATGGCCTACGTCTGGTCCCGGTCATTCAGAGCCGA
TCCCAGCTTCGCGCAATCTATGGTCCCGATGTCACCGACGAGATCATCGCCAATTGCGGGCTCGAGGTTG
TCTTCACGCCCAAGGAGCTAAAGGTCGCGAACGAACTTTCCGAACGGCTCGGCTTTTTCACGATGAGCGT
GAAATCCCGCAGCCGCACCATCCACGGGCTGCTGGCGAACCGAAGCATCTCGGAATCCGACCAGCGCCGC
GCACTCTTGCTGCCGCAGGAGCTGATGCAGCTACCCAAGAGCGAGCTCCTGCTCCTCCGCGCCGGCATCC
CGCCCATTCGAGGTCGCAAGATTGCCTATTACCGGATGCCGCGCTTCACGCGGCGAGTGATCGCTCCGCC
CGTGCTGCCCGCCCGTCCCATCGCGGCAATGCTTTCTTCCCCCACTCCGGCTTTAGAGCAGCACGGTGCT
GGCACGCCTGGGCTGAGTGGCACCCGCCGGCAACCGGCGACGAGCTCGGGGAACGCCATACCGGAGGAAA
TTGCGATGCGGGAAATGACCGAGGCCGAGCTTTCAGGCGCGGCAGAGATCACGGACGACATGCTGGTTCT
GGGTGACCTGGCCGAACTGCCGCCGCCGGGCGACGAGGCTGCCGCAATCGCCTTCGTGACGGCGATGGTC
GAGCGGGCAGTTTTACCACCGACCGGATCGGCATCCACGTCCCTCATGCAGGAAAGGGCAGCCCATGTCC
GCTGA
 Primer design