SecReT4
Protein ID: 294010444
T4SS name [ID]VirB [28]
Gene symbolvirB11
Locus tagSJA_C1-04580
StrainSphingobium japonicum UT26S
Repliconchromosome 1 [GenBank: NC_014006] [Browse all T4SS(s) in this replicon]
Location [Strand]467666..468670 [-]
Producttype IV secretory pathway VirB11 component
Component typeVirB11
UniProt IDD4YY60
KEGG IDsjp:SJA_C1-04580
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.1e-72, Aligned region: 12..313
Mg_chelatase [PF01078], Evalue: 3.3e-06, Aligned region: 153..195
AAA_29 [PF13555], Evalue: 2.2e-05, Aligned region: 149..188
Protein Sequence: 334 a.a.     [Download]
>gi|294010444|ref|YP_003543904.1| type IV secretory pathway VirB11 component [Sphingobium japonicum UT26S]
MRDTAVLRHYLEPLLPLLEPDDVTELVINRPGEAGIEDRQGWRWHELSELDSEWLGTLAVAAASFTHQDI
DGQTPICSTVLPGGERCQIVIPSVTPSGCPSFTIRKPSTVTLPIDQLARAGLFDTTRASARGLTETDAEL
VALRDAGDWPAFFKVAVAARKNILVSGATGSGKTTLAKALIQLIPPDERLLTIEDTRELIVPHRNVVHMV
YSSEGQGLAKVGPKQLLESALRMRPDRILLQELRDGTAFFYLRNVNSGHPGSITTVHAGSAAGAFEQLTL
LVKESEGGRDLARDDIRGLLRMLIDVVVQTRRHGGRFEVEEVYFHPKVGDAGAA
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|294009986|ref|NC_014006.1|:c468670-467666 Sphingobium japonicum UT26S chromosome 1, complete genome
ATGCGCGACACCGCCGTCCTTCGTCACTACCTCGAACCGCTTCTTCCGTTGCTGGAGCCAGATGATGTGA
CCGAGCTCGTCATCAACCGTCCGGGCGAGGCGGGAATCGAGGACCGGCAGGGGTGGCGATGGCATGAGCT
GTCCGAACTCGACAGCGAGTGGCTTGGAACGCTCGCCGTCGCCGCGGCAAGCTTCACGCACCAGGACATC
GATGGGCAGACCCCGATCTGTTCGACCGTCCTCCCAGGCGGCGAGCGCTGCCAGATCGTAATCCCGTCGG
TGACGCCGAGCGGCTGCCCGTCCTTTACGATACGCAAGCCCTCGACCGTAACCCTGCCGATCGACCAGCT
CGCACGCGCTGGCCTCTTTGACACGACGCGCGCGAGCGCCCGGGGCCTTACCGAAACCGACGCCGAGTTG
GTGGCACTTCGCGATGCGGGCGACTGGCCGGCCTTCTTCAAGGTCGCGGTCGCCGCGCGCAAGAATATCC
TGGTCAGCGGTGCAACCGGGTCCGGCAAGACGACCTTGGCGAAAGCGCTCATCCAGCTCATCCCGCCCGA
CGAGCGACTGCTTACGATCGAGGACACACGCGAACTCATCGTGCCCCATCGCAATGTCGTTCATATGGTC
TATTCGAGCGAGGGGCAGGGCCTTGCAAAGGTCGGTCCCAAGCAACTTCTCGAGAGCGCGCTGCGCATGC
GCCCGGATCGGATCCTGCTGCAGGAGCTGCGCGACGGCACCGCGTTCTTCTACCTGCGCAATGTCAATTC
GGGGCACCCTGGGTCGATCACCACGGTGCATGCCGGCTCTGCGGCGGGTGCCTTCGAGCAGCTGACGCTA
CTGGTCAAGGAATCCGAGGGCGGCCGAGATCTCGCGCGCGATGATATCCGCGGACTTTTGCGAATGCTCA
TCGATGTGGTCGTCCAGACCCGGCGCCATGGCGGCCGCTTCGAGGTCGAAGAGGTCTACTTCCACCCGAA
GGTGGGCGATGCCGGTGCAGCGTAG
 Primer design